Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPRE Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Protein tyrosine phosphatase receptor type E

Gene Aliases

HPTPE; protein tyrosine phosphatase, receptor type, epsilon polypeptide; PTPE; receptor-type tyrosine-protein phosphatase epsilon; R-PTP-EPSILON.

Gene ID

5791

Accession Number

https://www.ncbi.nlm.nih.gov/protein/AAH50062

Reactivity

Human, Mouse

Immunogen

PTPRE (AAH50062, 511 a.a. ~ 600 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Two alternatively spliced transcript variants of this gene have been reported, one of which encodes a receptor-type PTP that possesses a short extracellular domain, a single transmembrane region, and two tandem intracytoplasmic catalytic domains; Another one encodes a PTP that contains a distinct hydrophilic N-terminus, and thus represents a nonreceptor-type isoform of this PTP. Studies of the similar gene in mice suggested the regulatory roles of this PTP in RAS related signal transduction pathways, cytokines induced SATA signaling, as well as the activation of voltage-gated K+ channels. [provided by RefSeq

Clonality

Monoclonal

Clone

2D10

Type

Monoclonal Antibody

Sequence

WRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGI

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

PTPRE

Host or Source

Mouse

Protein Name

Homo sapiens protein tyrosine phosphatase, receptor type, E, mRNA (cDNA clone MGC:48280 IMAGE:5274802), complete cds|PTPRE protein [Homo sapiens]

Gene Name URL

PTPRE

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/BC050062

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCML1 (NM_001037535) Human Over-expression Lysate
LH04595V 100 µg

SCML1 (NM_001037535) Human Over-expression Lysate

Sign In for Pricing
View Details
TBX3 Antibody
A36259-100UL 100 µL

TBX3 Antibody

Sign In for Pricing
View Details
MFSD11 (NM_024311) Human Tagged ORF Clone
RG201197 10 µg

MFSD11 (NM_024311) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti Human CD11b Flow Cytometry Monoclonal Clone ICRF44 AF647 Ready To Use 200 Tests
IMSAHUCD11BICRF44CAF647200 200 Tests

Anti Human CD11b Flow Cytometry Monoclonal Clone ICRF44 AF647 Ready To Use 200 Tests

Sign In for Pricing
View Details
RORA Antibody
orb223220-01 25 µg

RORA Antibody

Sign In for Pricing
View Details
RORA Antibody
orb223220-02 50 µg

RORA Antibody

Sign In for Pricing
View Details