Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPN4 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Protein tyrosine phosphatase non-receptor type 4

Gene Aliases

MEG; megakaryocyte phosphatase; megakaryocyte protein-tyrosine phosphatase; protein tyrosine phosphatase MEG1; protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte) ; PTPase-MEG1; PTPMEG; PTPMEG1; tyrosine-protein phosphatase non-receptor type 4.

Gene ID

5775

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_002821

Reactivity

Human, Mouse

Immunogen

PTPN4 (NP_002821, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This protein contains a C-terminal PTP domain and an N-terminal domain homologous to the band 4.1 superfamily of cytoskeletal-associated proteins. This PTP has been shown to interact with glutamate receptor delta 2 and epsilon subunits, and is thought to play a role in signalling downstream of the glutamate receptors through tyrosine dephosphorylation. [provided by RefSeq

Clonality

Monoclonal

Clone

3C8

Type

Monoclonal Antibody

Sequence

KPLARKLMDWEVVSRNSISDDRLETQSLPSRSPPGTPNHRNSTFTQEGTRLRPSSVGHLVDHMVHTSPSEVFVNQRSPSSTQANSIVLESSPSQETPGDG

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG3 Kappa

NCBI Gene Symbol

PTPN4

Host or Source

Mouse

Protein Name

Homo sapiens protein tyrosine phosphatase, non-receptor type 4 (PTPN4), mRNA|tyrosine-protein phosphatase non-receptor type 4 [Homo sapiens]

Gene Name URL

PTPN4

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_002830

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bag3 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4432503 1.0 µg DNA

Bag3 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Ribosomal Protein L18 Polyclonal Antibody
RA29416-01 50 µL

Ribosomal Protein L18 Polyclonal Antibody

Sign In for Pricing
View Details
Ribosomal Protein L18 Polyclonal Antibody
RA29416-02 100 µL

Ribosomal Protein L18 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Monoclonal Contactin-3 Antibody (524518) [Alexa Fluor 532]
FAB6644X 0.1 mL

Rat Monoclonal Contactin-3 Antibody (524518) [Alexa Fluor 532]

Sign In for Pricing
View Details
4-Aminophenylphosphate sodium salt
GL6836-100mg 100 mg

4-Aminophenylphosphate sodium salt

Sign In for Pricing
View Details
DHX30 Rabbit Polyclonal Antibody
TA375460 100 µL

DHX30 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details