What is the catalog number for PTPN4 Antibody?

The catalog number for PTPN4 Antibody is OAAL00272-100UG.

What sizes are available for PTPN4 Antibody?

PTPN4 Antibody is available in the following size(s): 100 µg.

Is PTPN4 Antibody in stock?

PTPN4 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

PTPN4 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Protein tyrosine phosphatase non-receptor type 4

Gene Aliases

MEG; megakaryocyte phosphatase; megakaryocyte protein-tyrosine phosphatase; protein tyrosine phosphatase MEG1; protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte) ; PTPase-MEG1; PTPMEG; PTPMEG1; tyrosine-protein phosphatase non-receptor type 4.

Gene ID

5775

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_002821

Reactivity

Human, Mouse

Immunogen

PTPN4 (NP_002821, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This protein contains a C-terminal PTP domain and an N-terminal domain homologous to the band 4.1 superfamily of cytoskeletal-associated proteins. This PTP has been shown to interact with glutamate receptor delta 2 and epsilon subunits, and is thought to play a role in signalling downstream of the glutamate receptors through tyrosine dephosphorylation. [provided by RefSeq

Clonality

Monoclonal

Clone

3C8

Type

Monoclonal Antibody

Sequence

KPLARKLMDWEVVSRNSISDDRLETQSLPSRSPPGTPNHRNSTFTQEGTRLRPSSVGHLVDHMVHTSPSEVFVNQRSPSSTQANSIVLESSPSQETPGDG

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol