Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGIR Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Prostaglandin I2 receptor

Gene Aliases

IP; PGI receptor; PGI2 receptor; PRIPR; prostacyclin receptor; prostaglandin I2 (prostacyclin) receptor (IP) ; prostanoid IP receptor.

Gene ID

5739

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_000951

Reactivity

Human, Mouse

Immunogen

PTGIR (NP_000951, 296 a.a. ~ 386 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene is a member of the G-protein coupled receptor family 1 and has been shown to be a receptor for prostacyclin. Prostacyclin, the major product of cyclooxygenase in macrovascular endothelium, elicits a potent vasodilation and inhibition of platelet aggregation through binding to this receptor. [provided by RefSeq

Clonality

Monoclonal

Clone

2A7

Type

Monoclonal Antibody

Sequence

RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

PTGIR

Host or Source

Mouse

Protein Name

Homo sapiens prostaglandin I2 receptor (PTGIR), mRNA|prostacyclin receptor [Homo sapiens]

Gene Name URL

PTGIR

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_000960

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GINS1, NT (GINS1, KIAA0186, PSF1, DNA replication complex GINS protein PSF1, GINS complex subunit 1) (AP) discontinued
036042-AP 200 µL

GINS1, NT (GINS1, KIAA0186, PSF1, DNA replication complex GINS protein PSF1, GINS complex subunit 1) (AP) discontinued

Sign In for Pricing
View Details
Rabbit anti-human General transcription factor IIH subunit 5 polyclonal Antibody, Biotin conjugated
MBS1490780-01 0.05 mg

Rabbit anti-human General transcription factor IIH subunit 5 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human General transcription factor IIH subunit 5 polyclonal Antibody, Biotin conjugated
MBS1490780-02 0.1 mg

Rabbit anti-human General transcription factor IIH subunit 5 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human General transcription factor IIH subunit 5 polyclonal Antibody, Biotin conjugated
MBS1490780-03 5x 0.1 mg

Rabbit anti-human General transcription factor IIH subunit 5 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
PE Anti-Mouse CD19 Antibody
MBS4514359-01 0.025 mg

PE Anti-Mouse CD19 Antibody

Sign In for Pricing
View Details
PE Anti-Mouse CD19 Antibody
MBS4514359-02 0.05 mg

PE Anti-Mouse CD19 Antibody

Sign In for Pricing
View Details