Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Mediator complex subunit 1

Gene Aliases

Activator-recruited cofactor 205 kDa component; ARC205; CRSP1; CRSP200; DRIP205; DRIP230; mediator of RNA polymerase II transcription subunit 1; p53 regulatory protein RB18A; PBP; peroxisome proliferator-activated receptor-binding protein; PPAR-binding protein; PPARBP; PPARG binding protein; PPARGBP; RB18A; thyroid hormone receptor-associated protein complex 220 kDa component; thyroid hormone receptor-associated protein complex component TRAP220; thyroid receptor interacting protein 2; TRAP220; TR-interacting protein 2; TRIP2; TRIP-2; vitamin D receptor-interacting protein 230 kD; vitamin D receptor-interacting protein complex component DRIP205.

Gene ID

5469

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_004765

Reactivity

Human, Mouse

Immunogen

PPARBP (NP_004765, 1391 a.a. ~ 1490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor- (TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. It also regulates p53-dependent apoptosis and it is essential for adipogenesis. This protein is known to have the ability to self-oligomerize. [provided by RefSeq

Clonality

Monoclonal

Clone

1G3

Type

Monoclonal Antibody

Sequence

KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

MED1

Host or Source

Mouse

Protein Name

Homo sapiens mediator complex subunit 1 (MED1), mRNA|mediator of RNA polymerase II transcription subunit 1 [Homo sapiens]

Gene Name URL

MED1

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_004774

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Scolopendra viridicornis nigra Scolopendra 7997.01 Da toxin
MBS1199865-01 0.05 mg (E-Coli)

Recombinant Scolopendra viridicornis nigra Scolopendra 7997.01 Da toxin

Sign In for Pricing
View Details
Recombinant Scolopendra viridicornis nigra Scolopendra 7997.01 Da toxin
MBS1199865-02 0.2 mg (E-Coli)

Recombinant Scolopendra viridicornis nigra Scolopendra 7997.01 Da toxin

Sign In for Pricing
View Details
Recombinant Scolopendra viridicornis nigra Scolopendra 7997.01 Da toxin
MBS1199865-03 0.05 mg (Yeast)

Recombinant Scolopendra viridicornis nigra Scolopendra 7997.01 Da toxin

Sign In for Pricing
View Details
Recombinant Scolopendra viridicornis nigra Scolopendra 7997.01 Da toxin
MBS1199865-04 0.5 mg (E-Coli)

Recombinant Scolopendra viridicornis nigra Scolopendra 7997.01 Da toxin

Sign In for Pricing
View Details
Recombinant Scolopendra viridicornis nigra Scolopendra 7997.01 Da toxin
MBS1199865-05 0.05 mg (Baculovirus)

Recombinant Scolopendra viridicornis nigra Scolopendra 7997.01 Da toxin

Sign In for Pricing
View Details
Recombinant Scolopendra viridicornis nigra Scolopendra 7997.01 Da toxin
MBS1199865-06 0.2 mg (Yeast)

Recombinant Scolopendra viridicornis nigra Scolopendra 7997.01 Da toxin

Sign In for Pricing
View Details