Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPARD Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Peroxisome proliferator activated receptor delta

Gene Aliases

FAAR; NR1C2; NUC1; NUCI; NUCII; nuclear hormone receptor 1; nuclear receptor subfamily 1 group C member 2; peroxisome proliferator-activated receptor beta; peroxisome proliferator-activated receptor delta; PPARB; PPAR-beta; PPARD/MYO1D fusion; PPAR-delta.

Gene ID

5467

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_006229

Reactivity

Human, Mouse

Immunogen

PPARD (NP_006229, 56 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. PPARs are nuclear hormone receptors that bind peroxisome proliferators and control the size and number of peroxisomes produced by cells. PPARs mediate a variety of biological processes, and may be involved in the development of several chronic diseases, including diabetes, obesity, atherosclerosis, and cancer. This protein is a potent inhibitor of ligand-induced transcription activity of PPAR alpha and PPAR gamma. It may function as an integrator of transcription repression and nuclear receptor signaling. The expression of this gene is found to be elevated in colorectal cancer cells. The elevated expression can be repressed by adenomatosis polyposis coli (APC), a tumor suppressor protein related to APC/beta-catenin signaling pathway. Knockout studies in mice suggested the role of this protein in myelination of the corpus callosum, lipid metabolism, and epidermal cell proliferation. [provided by RefSeq

Clonality

Monoclonal

Clone

1G4

Type

Monoclonal Antibody

Sequence

DQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEG

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

PPARD

Host or Source

Mouse

Protein Name

Homo sapiens peroxisome proliferator activated receptor delta (PPARD), transcript variant 1, mRNA|peroxisome proliferator-activated receptor delta isoform 1 [Homo sapiens]

Gene Name URL

PPARD

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_006238

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMA6 siRNA (Human)
CRH3834-01 15 nmol

PSMA6 siRNA (Human)

Sign In for Pricing
View Details
PSMA6 siRNA (Human)
CRH3834-02 30 nmol

PSMA6 siRNA (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal SCYL1 Antibody
NBP1-33054 100 µL

Rabbit Polyclonal SCYL1 Antibody

Sign In for Pricing
View Details
CENPC2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
55318111 3x 1.0 µg

CENPC2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant IAV H3N2 Hemagglutinin / HA0 Protein (aa 1-566) [His] (A/Babol/36/2005)
VAng-Wyb7033-10g 10 µg

Recombinant IAV H3N2 Hemagglutinin / HA0 Protein (aa 1-566) [His] (A/Babol/36/2005)

Sign In for Pricing
View Details
Lentiviral human RECK shRNA (UAS) - Lentiviral human RECK shRNA (UAS) plasmid
GTR15121687 1 Vial

Lentiviral human RECK shRNA (UAS) - Lentiviral human RECK shRNA (UAS) plasmid

Sign In for Pricing
View Details