Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAFAH1B3 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Platelet activating factor acetylhydrolase 1b catalytic subunit 3

Gene Aliases

Epididymis secretory sperm binding protein; PAF acetylhydrolase 29 kDa subunit; PAF-AH 29 kDa subunit; PAFAH subunit gamma; PAF-AH subunit gamma; PAF-AH1b alpha 1 subunit; PAFAHG; platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa) ; platelet-activating factor acetylhydrolase IB subunit alpha1; platelet-activating factor acetylhydrolase IB subunit gamma.

Gene ID

5050

Accession Number

https://www.ncbi.nlm.nih.gov/protein/AAH03016

Reactivity

Human, Mouse, Rat

Immunogen

PAFAH1B3 (AAH03016, 1 a.a. ~ 231 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with mental retardation, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described. [provided by RefSeq

Clonality

Monoclonal

Clone

3G6

Type

Monoclonal Antibody

Sequence

MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2b Kappa

NCBI Gene Symbol

PAFAH1B3

Host or Source

Mouse

Protein Name

Homo sapiens platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa, mRNA (cDNA clone MGC:4046 IMAGE:2822228), complete cds|Platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa [Homo sapiens]

Gene Name URL

PAFAH1B3

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/BC003016

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trk C (7H6) Alexa Fluor® 546
sc-517245 AF546 200 µg/mL

Trk C (7H6) Alexa Fluor® 546

Sign In for Pricing
View Details
Rapgef2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV665983 1.0 µg DNA

Rapgef2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SP8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2262706 1.0 µg DNA

SP8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human TFPI  ELISA kit (4×96T)
LF-EK50794 4×96T

Human TFPI ELISA kit (4×96T)

Sign In for Pricing
View Details
NG2 Recombinant Antibody, RBITC Conjugated
bsm-52891R-RBITC-TR 20 µL

NG2 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Rabbit anti-Simian immunodeficiency virus (isolate F236/smH4)(SIV-sm)(Simian immunodeficiency virus sooty mangabey monkey) TAT Polyclonal Antibody
MBS7151999 Inquire

Rabbit anti-Simian immunodeficiency virus (isolate F236/smH4)(SIV-sm)(Simian immunodeficiency virus sooty mangabey monkey) TAT Polyclonal Antibody

Sign In for Pricing
View Details