Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A18AS Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Solute carrier family 22 member 18 antisense

Gene Aliases

Beckwith-Wiedemann region 1B; beckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein; Beckwith-Wiedemann syndrome chromosome region 1, candidate b; BWR1B; BWSCR1B; ORCTL2S; organic cation transporter-like 2 antisense; organic cation transporter-like protein 2 antisense protein; p27-Beckwith-Wiedemann region 1 B; p27-BWR1B; SLC22A1LS; solute carrier family 22 (organic cation transporter), member 18 antisense; solute carrier family 22 (organic cation transporter), member 1-like antisense; solute carrier family 22 member 18 antisense protein; solute carrier family 22 member 1-like antisense protein.

Gene ID

5003

Accession Number

https://www.ncbi.nlm.nih.gov/protein/AAH30237.1

Reactivity

Human, Mouse

Immunogen

SLC22A18AS (AAH30237.1, 1 a.a. ~ 150 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Clonality

Monoclonal

Clone

4B1

Type

Monoclonal Antibody

Sequence

MRCAEGAWWFSPDGPAGSAASIWPAEGAEGLPGQLGRDRLEVVYSVPDNVPGQNGSRRPLVCKITGKCLSVCSEENAKAGGCSAFPLLLSQLGARMTGREHAHKGPELTTPDSGLPRPPNPALAGFRALAQHSPPLGTSTPSAVLLSAAT

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

SLC22A18AS

Host or Source

Mouse

Protein Name

Homo sapiens solute carrier family 22 (organic cation transporter), member 18 antisense, mRNA (cDNA clone MGC:39960 IMAGE:4185944), complete cds|SLC22A18AS protein [Homo sapiens]

Gene Name URL

SLC22A18AS

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/BC030237.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae UPF0479 membrane protein YLL067W-A (YLL067W-A)
MBS7040015-01 0.02 mg

Recombinant Saccharomyces cerevisiae UPF0479 membrane protein YLL067W-A (YLL067W-A)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae UPF0479 membrane protein YLL067W-A (YLL067W-A)
MBS7040015-02 0.1 mg

Recombinant Saccharomyces cerevisiae UPF0479 membrane protein YLL067W-A (YLL067W-A)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae UPF0479 membrane protein YLL067W-A (YLL067W-A)
MBS7040015-03 5x 0.1 mg

Recombinant Saccharomyces cerevisiae UPF0479 membrane protein YLL067W-A (YLL067W-A)

Sign In for Pricing
View Details
Anti-Human ADRB1 Antibody (6B9), FITC
FHC34411 100 Tests

Anti-Human ADRB1 Antibody (6B9), FITC

Sign In for Pricing
View Details
Mouse Follistatin, FS ELISA Kit
MBS703755-01 24 Well (LIMIT 1)

Mouse Follistatin, FS ELISA Kit

Sign In for Pricing
View Details
Mouse Follistatin, FS ELISA Kit
MBS703755-02 48 Well

Mouse Follistatin, FS ELISA Kit

Sign In for Pricing
View Details