Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR2 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Receptor tyrosine kinase like orphan receptor 2

Gene Aliases

BDB; BDB1; neurotrophic tyrosine kinase receptor-related 2; NTRKR2; tyrosine-protein kinase transmembrane receptor ROR2.

Gene ID

4920

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_004551

Reactivity

Human, Mouse

Immunogen

ROR2 (NP_004551, 34 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene is a receptor protein tyrosine kinase and type I transmembrane protein that belongs to the ROR subfamily of cell surface receptors. The protein may be involved in the early formation of the chondrocytes and may be required for cartilage and growth plate development. Mutations in this gene can cause brachydactyly type B, a skeletal disorder characterized by hypoplasia/aplasia of distal phalanges and nails. In addition, mutations in this gene can cause the autosomal recessive form of Robinow syndrome, which is characterized by skeletal dysplasia with generalized limb bone shortening, segmental defects of the spine, brachydactyly, and a dysmorphic facial appearance. [provided by RefSeq

Clonality

Monoclonal

Clone

1F7

Type

Monoclonal Antibody

Sequence

EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKT

Applications

Enzyme-linked immunosorbent assay

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

ROR2

Host or Source

Mouse

Protein Name

Homo sapiens receptor tyrosine kinase like orphan receptor 2 (ROR2), transcript variant 1, mRNA|tyrosine-protein kinase transmembrane receptor ROR2 isoform 1 precursor [Homo sapiens]

Gene Name URL

ROR2

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_004560

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLCA3 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-13706R-BF750 100 µL

CLCA3 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
MMP19 (Cleaved-Tyr98) Rabbit Polyclonal Antibody
MBS9518448-01 0.05 mL

MMP19 (Cleaved-Tyr98) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MMP19 (Cleaved-Tyr98) Rabbit Polyclonal Antibody
MBS9518448-02 0.1 mL

MMP19 (Cleaved-Tyr98) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MMP19 (Cleaved-Tyr98) Rabbit Polyclonal Antibody
MBS9518448-03 5x 0.1 mL

MMP19 (Cleaved-Tyr98) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PTCH (Patched Homolog 1 (Drosophila), BCNS, FLJ26746, FLJ42602, HPE7, NBCCS, PTC, PTC1, PTCH, PTCH11) (MaxLight 650)
250620-ML650 100 µL

PTCH (Patched Homolog 1 (Drosophila), BCNS, FLJ26746, FLJ42602, HPE7, NBCCS, PTC, PTC1, PTCH, PTCH11) (MaxLight 650)

Sign In for Pricing
View Details
LAPTM4B ORF Vector (Human) (pORF)
26301011 1.0 µg DNA

LAPTM4B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details