Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR2 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Receptor tyrosine kinase like orphan receptor 2

Gene Aliases

BDB; BDB1; neurotrophic tyrosine kinase receptor-related 2; NTRKR2; tyrosine-protein kinase transmembrane receptor ROR2.

Gene ID

4920

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_004551

Reactivity

Human, Mouse

Immunogen

ROR2 (NP_004551, 34 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene is a receptor protein tyrosine kinase and type I transmembrane protein that belongs to the ROR subfamily of cell surface receptors. The protein may be involved in the early formation of the chondrocytes and may be required for cartilage and growth plate development. Mutations in this gene can cause brachydactyly type B, a skeletal disorder characterized by hypoplasia/aplasia of distal phalanges and nails. In addition, mutations in this gene can cause the autosomal recessive form of Robinow syndrome, which is characterized by skeletal dysplasia with generalized limb bone shortening, segmental defects of the spine, brachydactyly, and a dysmorphic facial appearance. [provided by RefSeq

Clonality

Monoclonal

Clone

1F7

Type

Monoclonal Antibody

Sequence

EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKT

Applications

Enzyme-linked immunosorbent assay

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

ROR2

Host or Source

Mouse

Protein Name

Homo sapiens receptor tyrosine kinase like orphan receptor 2 (ROR2), transcript variant 1, mRNA|tyrosine-protein kinase transmembrane receptor ROR2 isoform 1 precursor [Homo sapiens]

Gene Name URL

ROR2

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_004560

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICA1 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-11349R-PE-Cy5.5 100 µL

ICA1 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal Ataxin-3 Antibody
NBP3-33328-100ul 100 µL

Rabbit Monoclonal Ataxin-3 Antibody

Sign In for Pricing
View Details
SHISA9 AAV Vector (Mouse) (CMV)
43722104 1 µg

SHISA9 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Cfl2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
15988114 3x 1.0 µg

Cfl2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Acrosin (ACR) Antibody
abx147934-01 50 µg

Acrosin (ACR) Antibody

Sign In for Pricing
View Details
Acrosin (ACR) Antibody
abx147934-02 100 µg

Acrosin (ACR) Antibody

Sign In for Pricing
View Details