Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NP Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Purine nucleoside phosphorylase

Gene Aliases

Epididymis secretory sperm binding protein Li 156an; HEL-S-156an; inosine phosphorylase; inosine-guanosine phosphorylase; NP; PRO1837; PUNP; purine nucleoside phosphorylase; purine-nucleoside:orthophosphate ribosyltransferase.

Gene ID

4860

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_000261.1

Reactivity

Human, Mouse

Immunogen

NP (NP_000261.1, 1 a.a. ~ 289 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2. [provided by RefSeq

Clonality

Monoclonal

Clone

600000

Type

Monoclonal Antibody

Sequence

MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

PNP

Host or Source

Mouse

Protein Name

Homo sapiens purine nucleoside phosphorylase (PNP), mRNA|purine nucleoside phosphorylase [Homo sapiens]

Gene Name URL

PNP

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_000270.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

ErbB2 (Receptor Tyrosine-protein Kinase erbB-2, Metastatic Lymph Node Gene 19 Protein, MLN 19, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine Kinase-type Cell Surface Receptor HER2, CD340, p185erbB2, HER2, MLN19, NEU, NGL) (Biotin) discontinued
217343-Biotin 100 µL

ErbB2 (Receptor Tyrosine-protein Kinase erbB-2, Metastatic Lymph Node Gene 19 Protein, MLN 19, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine Kinase-type Cell Surface Receptor HER2, CD340, p185erbB2, HER2, MLN19, NEU, NGL) (Biotin) discontinued

Sign In for Pricing
View Details
Human Apoprotein A2 (apo - A2) ELISA
QY-E05618 96 Tests

Human Apoprotein A2 (apo - A2) ELISA

Sign In for Pricing
View Details
Human B3GALT6 Pre-designed siRNA Set B
SI001377B 1 Each

Human B3GALT6 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Sheep Tumor necrosis factor α (TNF-α) ELISA KIT
YLA0031SH-01 48 Tests

Sheep Tumor necrosis factor α (TNF-α) ELISA KIT

Sign In for Pricing
View Details
Sheep Tumor necrosis factor α (TNF-α) ELISA KIT
YLA0031SH-02 96 Tests

Sheep Tumor necrosis factor α (TNF-α) ELISA KIT

Sign In for Pricing
View Details
CD68 Protein (C-His, Human)
P502213 100 µg

CD68 Protein (C-His, Human)

Sign In for Pricing
View Details