Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NME2 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

NME/NM23 nucleoside diphosphate kinase 2

Gene Aliases

C-myc purine-binding transcription factor PUF; c-myc transcription factor; epididymis secretory sperm binding protein Li 155an; HEL-S-155an; histidine protein kinase NDKB; NDKB; NDP kinase B; NDPKB; NDPK-B; NM23B; NM23-H2; non-metastatic cells 2, protein (NM23) expressed in; non-metastatic cells 2, protein (NM23B) expressed in; nucleoside diphosphate kinase B; nucleotide diphosphate kinase B; PUF.

Gene ID

4831

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_002503

Reactivity

Human, Mouse, Rat

Immunogen

NME2 (NP_002503, 51 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq

Clonality

Monoclonal

Clone

10000

Type

Monoclonal Antibody

Sequence

HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG3 Kappa

NCBI Gene Symbol

NME2

Host or Source

Mouse

Protein Name

Homo sapiens NME/NM23 nucleoside diphosphate kinase 2 (NME2), transcript variant 1, mRNA|nucleoside diphosphate kinase B isoform a [Homo sapiens]

Gene Name URL

NME2

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_002512

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal HDC Antibody
NBP3-05048-20ul 20 µL

Rabbit Polyclonal HDC Antibody

Sign In for Pricing
View Details
ACP4 (NM_033068) Human Over-expression Lysate
LH13064V 100 µg

ACP4 (NM_033068) Human Over-expression Lysate

Sign In for Pricing
View Details
Human SCARB2 Protein (Arg 27-Thr 432) [Fc]
VAng-2682Lsx-100g 100 µg

Human SCARB2 Protein (Arg 27-Thr 432) [Fc]

Sign In for Pricing
View Details
STFR W006-600x200-PE-CRD/1 AC Signs
827224 Card of 1 Pictogram(s)

STFR W006-600x200-PE-CRD/1 AC Signs

Sign In for Pricing
View Details
Rat T-cell surface glycoprotein CD8 alpha chain,Cd8a ELISA KIT
ELI-03112r 96 Tests

Rat T-cell surface glycoprotein CD8 alpha chain,Cd8a ELISA KIT

Sign In for Pricing
View Details
PAX6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1598806 1.0 µg DNA

PAX6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details