Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFATC2 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Nuclear factor of activated T cells 2

Gene Aliases

NFAT pre-existing subunit; NFAT transcription complex, preexisting component; NFAT1; NF-ATc2; NFATP; nuclear factor of activated T-cells, cytoplasmic 2; nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2; nuclear factor of activated T-cells, preexisting component; preexisting nuclear factor of activated T-cells 2; T cell transcription factor NFAT1.

Gene ID

4773

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_036472

Reactivity

Human, Mouse

Immunogen

NFATC2 (NP_036472, 812 a.a. ~ 921 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene is a member of the nuclear factor of activated T cells (NFAT) family. The product of this gene is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR) . This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Clonality

Monoclonal

Clone

2A4

Type

Monoclonal Antibody

Sequence

HYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDELIDTRLSWIQNIL

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

NFATC2

Host or Source

Mouse

Protein Name

Homo sapiens nuclear factor of activated T cells 2 (NFATC2), transcript variant 1, mRNA|nuclear factor of activated T-cells, cytoplasmic 2 isoform B [Homo sapiens]

Gene Name URL

NFATC2

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_012340

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LAYN/Layilin, C-Fc
MBS1576079-01 0.1 mg

Recombinant Human LAYN/Layilin, C-Fc

Sign In for Pricing
View Details
Recombinant Human LAYN/Layilin, C-Fc
MBS1576079-02 1 mg

Recombinant Human LAYN/Layilin, C-Fc

Sign In for Pricing
View Details
Recombinant Human LAYN/Layilin, C-Fc
MBS1576079-03 5x 1 mg

Recombinant Human LAYN/Layilin, C-Fc

Sign In for Pricing
View Details
Recombinant Human Vitronectin
MBS7621112-01 0.01 mg

Recombinant Human Vitronectin

Sign In for Pricing
View Details
Recombinant Human Vitronectin
MBS7621112-02 0.05 mg

Recombinant Human Vitronectin

Sign In for Pricing
View Details
Recombinant Human Vitronectin
MBS7621112-03 0.5 mg

Recombinant Human Vitronectin

Sign In for Pricing
View Details