Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MUSK Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Muscle associated receptor tyrosine kinase

Gene Aliases

CMS9; FADS; FADS1; muscle, skeletal receptor tyrosine-protein kinase; muscle, skeletal, receptor tyrosine kinase; muscle-specific kinase receptor; muscle-specific tyrosine-protein kinase receptor.

Gene ID

4593

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_005583

Reactivity

Human, Mouse

Immunogen

MUSK (NP_005583, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

Intercellular communication is often mediated by receptors on the surface of one cell that recognize and are activated by specific protein ligands released by other cells. Members of one class of cell surface receptors, receptor tyrosine kinases (RTKs), are characterized by having a cytoplasmic domain containing intrinsic tyrosine kinase activity. This kinase activity is regulated by the binding of a cognate ligand to the extracellular portion of the receptor. DeChiara et al. (1996) [PubMed 8653786] noted that the RTKs, known to be expressed in cell type-specific fashions, play a role critical for the growth and differentiation of those cell types. For example, members of the neural-specific TRK family that recognize nerve growth factor are absolutely required for the survival and development of discrete neuronal subpopulations, and the receptor tyrosine kinases TIE1 (MIM 600222) and TIE2 (MIM 600221) play a critical role in the development of normal blood vessels.[supplied by OMIM

Clonality

Monoclonal

Clone

400000

Type

Monoclonal Antibody

Sequence

ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEALLCNHIFQECSPGVVPTPIPICREYCLA

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

MUSK

Host or Source

Mouse

Protein Name

Homo sapiens muscle associated receptor tyrosine kinase (MUSK), transcript variant 1, mRNA|muscle, skeletal receptor tyrosine-protein kinase isoform 1 [Homo sapiens]

Gene Name URL

MUSK

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_005592

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coelenterazine h
T14994-01 500 µg

Coelenterazine h

Sign In for Pricing
View Details
Coelenterazine h
T14994-02 1 mg

Coelenterazine h

Sign In for Pricing
View Details
Coelenterazine h
T14994-03 5 mg

Coelenterazine h

Sign In for Pricing
View Details
Coelenterazine h
T14994-04 10 mg

Coelenterazine h

Sign In for Pricing
View Details
Coelenterazine h
T14994-05 25 mg

Coelenterazine h

Sign In for Pricing
View Details
Coelenterazine h
T14994-06 50 mg

Coelenterazine h

Sign In for Pricing
View Details