Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEF2B Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

BORCS8-MEF2B readthrough

Gene Aliases

LOC729991-MEF2B; LOC729991-MEF2B readthrough; MEF2B; MEF2BNB-MEF2B; MEF2BNB-MEF2B readthrough; myocyte enhancer factor 2B; myocyte-specific enhancer factor 2B; RSRFR2; serum response factor-like protein 2.

Gene ID

4207

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_005910.1

Reactivity

Human, Mouse

Immunogen

MEF2B (NP_005910.1, 165 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene represents numerous read-through transcripts that span geneID:729991 and 100271849. Many read-through transcripts are predicted to be nonsense-mediated decay (NMD) candidates, and are thought to be non-coding. Some transcripts are predicted to be capable of translation reinitation at a downstream AUG, resulting in expression of at least one isoform of myocyte enhancer factor 2B (MEF2B) from this read-through locus. At least one additional MEF2B variant and isoform can be expressed from a downstream promoter, and is annotated on geneID:100271849. [provided by RefSeq

Clonality

Monoclonal

Clone

4B5

Type

Monoclonal Antibody

Sequence

SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

BORCS8-MEF2B

Host or Source

Mouse

Protein Name

Homo sapiens BORCS8-MEF2B readthrough (BORCS8-MEF2B), transcript variant 1, mRNA|myocyte enhancer factor 2B isoform b [Homo sapiens]

Gene Name URL

BORCS8-MEF2B

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_005919

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse PUF60 Protein, His (Fc)-Avi-tagged
PUF60-7299M 50 µg

Recombinant Mouse PUF60 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
MECR (NM_016011) Human Recombinant Protein
TP324634M 100 µg

MECR (NM_016011) Human Recombinant Protein

Sign In for Pricing
View Details
GATA4 Antibody
orb675571-01 50 µg

GATA4 Antibody

Sign In for Pricing
View Details
GATA4 Antibody
orb675571-02 100 µg

GATA4 Antibody

Sign In for Pricing
View Details
UGGT2 (UDP-glucose:glycoprotein Glucosyltransferase 2, UGT2, hUGT2, UDP--Glc:glycoprotein Glucosyltransferase 2, UGCGL2, UDP-glucose Ceramide Glucosyltransferase-like 1) (PE)
MBS6397973-01 0.1 mL

UGGT2 (UDP-glucose:glycoprotein Glucosyltransferase 2, UGT2, hUGT2, UDP--Glc:glycoprotein Glucosyltransferase 2, UGCGL2, UDP-glucose Ceramide Glucosyltransferase-like 1) (PE)

Sign In for Pricing
View Details
UGGT2 (UDP-glucose:glycoprotein Glucosyltransferase 2, UGT2, hUGT2, UDP--Glc:glycoprotein Glucosyltransferase 2, UGCGL2, UDP-glucose Ceramide Glucosyltransferase-like 1) (PE)
MBS6397973-02 5x 0.1 mL

UGGT2 (UDP-glucose:glycoprotein Glucosyltransferase 2, UGT2, hUGT2, UDP--Glc:glycoprotein Glucosyltransferase 2, UGCGL2, UDP-glucose Ceramide Glucosyltransferase-like 1) (PE)

Sign In for Pricing
View Details