Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L1CAM Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

L1 cell adhesion molecule

Gene Aliases

Antigen identified by monoclonal antibody R1; CAML1; CD171; HSAS; HSAS1; MASA; MIC5; NCAM-L1; N-CAML1; N-CAM-L1; neural cell adhesion molecule L1; S10; SPG1.

Gene ID

3897

Accession Number

NP_000416

Reactivity

Human, Mouse

Immunogen

L1CAM (NP_000416, 23 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause three X-linked neurological syndromes known by the acronym CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus) . Alternative splicing of a neuron-specific exon is thought to be functionally relevant. [provided by RefSeq

Clonality

Monoclonal

Clone

3B10

Type

Monoclonal Antibody

Sequence

PEEYEGHHVMEPPVITEQSPRRLVVFPTDDISLKCEASGKPEVQFRWTRDGVHFKPKEELGVTVYQSPHSGSFTITGNNSNFAQRFQGIYRCFASNKLGTAMSHEIRLMA

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

L1CAM

Host or Source

Mouse

Protein Name

Homo sapiens L1 cell adhesion molecule (L1CAM), transcript variant 1, mRNA|neural cell adhesion molecule L1 isoform 1 precursor [Homo sapiens]

Gene Name URL

L1CAM

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_000425,NP_000416

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM108A10P 3'UTR GFP Stable Cell Line
TU057508 1.0 mL

FAM108A10P 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Spem2 Mouse shRNA Lentiviral Particle (Locus ID 108803)
TL505856V 500 µL Each

Spem2 Mouse shRNA Lentiviral Particle (Locus ID 108803)

Sign In for Pricing
View Details
Candidatus Entotheonella gemina ETSY2_08400 Rabbit Polyclonal Antibody (HRP)
orb2570619 200 µL

Candidatus Entotheonella gemina ETSY2_08400 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Phospho-MAP3K7IP1 (Thr431) Rabbit Polyclonal Antibody (PerCP)
orb2411139 100 µL

Phospho-MAP3K7IP1 (Thr431) Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Olfr1016 Mouse shRNA Plasmid (Locus ID 257915)
TL515302 1 Kit

Olfr1016 Mouse shRNA Plasmid (Locus ID 257915)

Sign In for Pricing
View Details
JMJD6 Polyclonal Antibody
RD78198A-01 20 µL

JMJD6 Polyclonal Antibody

Sign In for Pricing
View Details