Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ING1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Inhibitor of growth family member 1

Gene Aliases

Growth inhibitor ING1; growth inhibitory protein ING1; inhibitor of growth protein 1; p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a; tumor suppressor ING1.

Gene ID

3621

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_937862.1

Reactivity

Human, Mouse

Immunogen

ING1 (NP_937862.1, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq

Clonality

Monoclonal

Clone

20

Type

Monoclonal Antibody

Sequence

DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 kappa

NCBI Gene Symbol

ING1

Host or Source

Mouse

Protein Name

Homo sapiens inhibitor of growth family member 1 (ING1), transcript variant 1, mRNA|inhibitor of growth protein 1 isoform A [Homo sapiens]

Gene Name URL

ING1

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_198219.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXA10 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-2502R-BF405-01 20 µL

HOXA10 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
HOXA10 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-2502R-BF405-02 100 µL

HOXA10 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Recombinant Bacillus cereus Putative ATP:guanido phosphotransferase BCE_0080 (BCE_0080)
MBS1452037-01 0.02 mg (E-Coli)

Recombinant Bacillus cereus Putative ATP:guanido phosphotransferase BCE_0080 (BCE_0080)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Putative ATP:guanido phosphotransferase BCE_0080 (BCE_0080)
MBS1452037-02 0.02 mg (Yeast)

Recombinant Bacillus cereus Putative ATP:guanido phosphotransferase BCE_0080 (BCE_0080)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Putative ATP:guanido phosphotransferase BCE_0080 (BCE_0080)
MBS1452037-03 0.1 mg (E-Coli)

Recombinant Bacillus cereus Putative ATP:guanido phosphotransferase BCE_0080 (BCE_0080)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Putative ATP:guanido phosphotransferase BCE_0080 (BCE_0080)
MBS1452037-04 0.1 mg (Yeast)

Recombinant Bacillus cereus Putative ATP:guanido phosphotransferase BCE_0080 (BCE_0080)

Sign In for Pricing
View Details