Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICT1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Mitochondrial ribosomal protein L58

Gene Aliases

39S ribosomal protein L58, mitochondrial; digestion substraction 1; DS1; DS-1; ICT1; immature colon carcinoma transcript 1 protein; mitochondrial large ribosomal subunit protein ICT1; mitochondrial large ribosomal subunit protein mL62; MRP-L58; peptidyl-tRNA hydrolase ICT1, mitochondrial.

Gene ID

3396

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_001536

Reactivity

Human, Mouse

Immunogen

ICT1 (NP_001536, 107 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The adult colon epithelium contains 3 differentiated cell types that arise from a multipotent stem cell. Deviation from the normal maturation pathway by neoplastic transformation is thought to initiate in stem cells or their early descendants. One potential marker is ICT1 whose mRNA and protein were more highly expressed in undifferentiated than in differentiated cells. [provided by RefSeq

Clonality

Monoclonal

Clone

6F8

Type

Monoclonal Antibody

Sequence

TAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

MRPL58

Host or Source

Mouse

Protein Name

Homo sapiens mitochondrial ribosomal protein L58 (MRPL58), transcript variant 1, mRNA|peptidyl-tRNA hydrolase ICT1, mitochondrial isoform 1 precursor [Homo sapiens]

Gene Name URL

MRPL58

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_001545

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Zinc finger CCCH domain-containing protein 14 (ZC3H14) ELISA Kit
MBS7202183-01 48 Well

Rabbit Zinc finger CCCH domain-containing protein 14 (ZC3H14) ELISA Kit

Sign In for Pricing
View Details
Rabbit Zinc finger CCCH domain-containing protein 14 (ZC3H14) ELISA Kit
MBS7202183-02 96 Well

Rabbit Zinc finger CCCH domain-containing protein 14 (ZC3H14) ELISA Kit

Sign In for Pricing
View Details
Rabbit Zinc finger CCCH domain-containing protein 14 (ZC3H14) ELISA Kit
MBS7202183-03 5x 96 Well

Rabbit Zinc finger CCCH domain-containing protein 14 (ZC3H14) ELISA Kit

Sign In for Pricing
View Details
Rabbit Zinc finger CCCH domain-containing protein 14 (ZC3H14) ELISA Kit
MBS7202183-04 10x 96 Well

Rabbit Zinc finger CCCH domain-containing protein 14 (ZC3H14) ELISA Kit

Sign In for Pricing
View Details
SCRN1 Antibody Blocking peptide
orb1449051 500 µg

SCRN1 Antibody Blocking peptide

Sign In for Pricing
View Details
2- (4-Fluoro-2-nitrophenoxy) acetohydrazide
413758-01 100 mg

2- (4-Fluoro-2-nitrophenoxy) acetohydrazide

Sign In for Pricing
View Details