What is the catalog number for HOXD11 Antibody?

The catalog number for HOXD11 Antibody is OAAL00149-100UG.

What sizes are available for HOXD11 Antibody?

HOXD11 Antibody is available in the following size(s): 100 µg.

Is HOXD11 Antibody in stock?

HOXD11 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

HOXD11 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Homeobox D11

Gene Aliases

Homeo box 4F; homeo box D11; homeobox protein Hox-4F; homeobox protein Hox-D11; HOX4; Hox-4.6, mouse, homolog of; HOX4F.

Gene ID

3237

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_067015

Reactivity

Human, Mouse

Immunogen

HOXD11 (NP_067015, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. The product of the mouse Hoxd11 gene plays a role in forelimb morphogenesis. [provided by RefSeq

Clonality

Monoclonal

Clone

6D8

Type

Monoclonal Antibody

Sequence

MNDFDECGQSAASMYLPGCAYYVAPSDFASKPSFLSQPSSCQMTFPYSSNLAPHVQPVREVAFRDYGLERAKWPYR

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol