Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLI3 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

GLI family zinc finger 3

Gene Aliases

ACLS; GCPS; GLI3-190; GLI3FL; GLI-Kruppel family member GLI3; glioma-associated oncogene family zinc finger 3; oncogene GLI3; PAPA; PAP-A; PAPA1; PAPB; PHS; PPDIV; transcriptional activator GLI3; zinc finger protein GLI3.

Gene ID

2737

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_000159

Reactivity

Human, Mouse

Immunogen

GLI3 (NP_000159, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a protein which belongs to the C2H2-type zinc finger proteins subclass of the Gli family. They are characterized as DNA-binding transcription factors and are mediators of Sonic hedgehog (Shh) signaling. The protein encoded by this gene localizes in the cytoplasm and activates patched Drosophila homolog (PTCH) gene expression. It is also thought to play a role during embryogenesis. Mutations in this gene have been associated with several diseases, including Greig cephalopolysyndactyly syndrome, Pallister-Hall syndrome, preaxial polydactyly type IV, and postaxial polydactyly types A1 and B. [provided by RefSeq

Clonality

Monoclonal

Clone

1H7

Type

Monoclonal Antibody

Sequence

MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITMQPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFA

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2b Kappa

NCBI Gene Symbol

GLI3

Host or Source

Mouse

Protein Name

Homo sapiens GLI family zinc finger 3 (GLI3), mRNA|transcriptional activator GLI3 [Homo sapiens]

Gene Name URL

GLI3

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_000168

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Prochlorococcus marinus Photosystem Q (B) protein
MBS1225406 Inquire

Recombinant Prochlorococcus marinus Photosystem Q (B) protein

Sign In for Pricing
View Details
Recombinant Geobacter sp. Ribosome maturation factor RimM (rimM)
MBS1143163-01 0.02 mg (E-Coli)

Recombinant Geobacter sp. Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Geobacter sp. Ribosome maturation factor RimM (rimM)
MBS1143163-02 0.1 mg (E-Coli)

Recombinant Geobacter sp. Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Geobacter sp. Ribosome maturation factor RimM (rimM)
MBS1143163-03 0.02 mg (Yeast)

Recombinant Geobacter sp. Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Geobacter sp. Ribosome maturation factor RimM (rimM)
MBS1143163-04 0.1 mg (Yeast)

Recombinant Geobacter sp. Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Geobacter sp. Ribosome maturation factor RimM (rimM)
MBS1143163-05 0.02 mg (Baculovirus)

Recombinant Geobacter sp. Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details