What is the catalog number for GLI3 Antibody?

The catalog number for GLI3 Antibody is OAAL00124-100UG.

What sizes are available for GLI3 Antibody?

GLI3 Antibody is available in the following size(s): 100 µg.

Is GLI3 Antibody in stock?

GLI3 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

GLI3 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

GLI family zinc finger 3

Gene Aliases

ACLS; GCPS; GLI3-190; GLI3FL; GLI-Kruppel family member GLI3; glioma-associated oncogene family zinc finger 3; oncogene GLI3; PAPA; PAP-A; PAPA1; PAPB; PHS; PPDIV; transcriptional activator GLI3; zinc finger protein GLI3.

Gene ID

2737

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_000159

Reactivity

Human, Mouse

Immunogen

GLI3 (NP_000159, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a protein which belongs to the C2H2-type zinc finger proteins subclass of the Gli family. They are characterized as DNA-binding transcription factors and are mediators of Sonic hedgehog (Shh) signaling. The protein encoded by this gene localizes in the cytoplasm and activates patched Drosophila homolog (PTCH) gene expression. It is also thought to play a role during embryogenesis. Mutations in this gene have been associated with several diseases, including Greig cephalopolysyndactyly syndrome, Pallister-Hall syndrome, preaxial polydactyly type IV, and postaxial polydactyly types A1 and B. [provided by RefSeq

Clonality

Monoclonal

Clone

1H7

Type

Monoclonal Antibody

Sequence

MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITMQPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFA

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol