Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLE1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

GLE1 RNA export mediator

Gene Aliases

CAAHC; CAAHD; GLE1 RNA export mediator homolog; GLE1L; GLE1-like protein; GLE1-like, RNA export mediator; hGLE1; LCCS; LCCS1; nucleoporin GLE1.

Gene ID

2733

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_001003722.1

Reactivity

Human, Mouse

Immunogen

GLE1 (NP_001003722.1, 140 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a predicted 75-kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly (A) +RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly (A) +RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes. This localization suggests that GLE1L may act at a terminal step in the export of mature RNA messages to the cytoplasm. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Clonality

Monoclonal

Clone

1D8

Type

Monoclonal Antibody

Sequence

RMKGTEGLRLWQEEQERKVQALSEMASEQLKRFDEWKELKQHKEFQDLREVMEKSSREALGHQEKLKAEHRHRAKILNLKLREAEQQRVKQAEQERLRKEE

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

GLE1

Host or Source

Mouse

Protein Name

Homo sapiens GLE1, RNA export mediator (GLE1), transcript variant 1, mRNA|nucleoporin GLE1 isoform 1 [Homo sapiens]

Gene Name URL

GLE1

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_001003722

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gnal Mouse shRNA Lentiviral Particle (Locus ID 14680)
TL512543V 500 µL Each

Gnal Mouse shRNA Lentiviral Particle (Locus ID 14680)

Sign In for Pricing
View Details
Guinea Pig DSP ELISA Kit
EGD0066 96 Tests

Guinea Pig DSP ELISA Kit

Sign In for Pricing
View Details
C1GALT1C1 Peptide - N-terminal region
orb2001377 100 µg

C1GALT1C1 Peptide - N-terminal region

Sign In for Pricing
View Details
Quick Step Rat Leukotriene B4, LT-B4 ELISA Kit
QS0445Ra-01 48 Tests

Quick Step Rat Leukotriene B4, LT-B4 ELISA Kit

Sign In for Pricing
View Details
Quick Step Rat Leukotriene B4, LT-B4 ELISA Kit
QS0445Ra-02 96 Tests

Quick Step Rat Leukotriene B4, LT-B4 ELISA Kit

Sign In for Pricing
View Details
GABARAP (E-8) Alexa Fluor® 680
sc-377300 AF680 200 µg/mL

GABARAP (E-8) Alexa Fluor® 680

Sign In for Pricing
View Details