Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJA1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Gap junction protein alpha 1

Gene Aliases

AVSD3; CMDR; connexin-43; CX43; EKVP; EKVP3; gap junction 43 kDa heart protein; gap junction alpha-1 protein; gap junction protein, alpha 1, 43kDa; GJAL; HLHS1; HSS; ODDD; PPKCA.

Gene ID

2697

Accession Number

https://www.ncbi.nlm.nih.gov/protein/AAH26329

Reactivity

Human, Mouse

Immunogen

GJA1 (AAH26329, 261 a.a. ~ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. The encoded protein is the major protein of gap junctions in the heart that are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. A related intronless pseudogene has been mapped to chromosome 5. Mutations in this gene have been associated with oculodentodigital dysplasia and heart malformations. [provided by RefSeq

Clonality

Monoclonal

Clone

300000

Type

Monoclonal Antibody

Sequence

GSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVD*

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

GJA1

Host or Source

Mouse

Protein Name

Gap junction protein, alpha 1, 43kDa [Homo sapiens]|Homo sapiens gap junction protein, alpha 1, 43kDa, mRNA (cDNA clone MGC:26323 IMAGE:4794131), complete cds

Gene Name URL

GJA1

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/BC026329

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus Aureus acpP Protein (aa 1-77) (strain Mu3 / ATCC 700698)
VAng-Cr5592-50gEcoli 50 µg (E. coli)

Recombinant Staphylococcus Aureus acpP Protein (aa 1-77) (strain Mu3 / ATCC 700698)

Sign In for Pricing
View Details
Gm3286 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
21983124 3x 1.0µg DNA

Gm3286 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
IL-15 Antibody
43-221 0.1 mg

IL-15 Antibody

Sign In for Pricing
View Details
Hoxa1 Antibody - C-terminal region : FITC (ARP37062_P050-FITC)
ARP37062_P050-FITC 100 µL

Hoxa1 Antibody - C-terminal region : FITC (ARP37062_P050-FITC)

Sign In for Pricing
View Details
Mouse Scimp qPCR Primer Pair
QM71042S 200 Tests

Mouse Scimp qPCR Primer Pair

Sign In for Pricing
View Details
Anti-Mouse TPO Polyclonal Antibody
PMC23601 100 μg

Anti-Mouse TPO Polyclonal Antibody

Sign In for Pricing
View Details