Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRA1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

GDNF family receptor alpha 1

Gene Aliases

GDNF family receptor alpha-1; GDNF receptor alpha 1d; GDNF receptor alpha 1e; GDNFR; GDNFRA; GDNFR-alpha-1; GFRalpha-1; GFR-ALPHA-1; Glial cell line-derived neurotrophic factor receptor alpha; GPI-linked anchor protein; PI-linked cell-surface accessory protein; RET ligand 1; RET1L; RETL1; TGF-beta-related neurotrophic factor receptor 1; TRNR1.

Gene ID

2674

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_005255

Reactivity

Human, Mouse

Immunogen

GFRA1 (NP_005255, 32 a.a. ~ 119 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol (GPI) -linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq

Clonality

Monoclonal

Clone

4D8

Type

Monoclonal Antibody

Sequence

ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2b Kappa

NCBI Gene Symbol

GFRA1

Host or Source

Mouse

Protein Name

GDNF family receptor alpha-1 isoform a preproprotein [Homo sapiens]|Homo sapiens GDNF family receptor alpha 1 (GFRA1), transcript variant 1, mRNA

Gene Name URL

GFRA1

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_005264

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yes1 (NM_009535) Mouse Tagged Lenti ORF Clone
MR208634L4 10 µg

Yes1 (NM_009535) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Escherichia coli Inner membrane protein yidH (yidH), partial
MBS7062440 Inquire

Recombinant Escherichia coli Inner membrane protein yidH (yidH), partial

Sign In for Pricing
View Details
PCSK1N Human Pre-designed siRNA Set A
HY-RS10171 1 Set

PCSK1N Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anxa10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6646805 3x 1.0 µg

Anxa10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Apolipoprotein A1 (APOA1)
MBS2043277-01 0.1 mL

PE-Linked Polyclonal Antibody to Apolipoprotein A1 (APOA1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Apolipoprotein A1 (APOA1)
MBS2043277-02 0.2 mL

PE-Linked Polyclonal Antibody to Apolipoprotein A1 (APOA1)

Sign In for Pricing
View Details