Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF8 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Fibroblast growth factor 8

Gene Aliases

AIGF; androgen-induced growth factor; FGF-8; fibroblast growth factor 8; fibroblast growth factor 8 (androgen-induced) ; HBGF-8; heparin-binding growth factor 8; HH6; KAL6.

Gene ID

2253

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_149354

Reactivity

Human, Mouse

Immunogen

FGF8 (NP_149354, 65 a.a. ~ 133 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants. [provided by RefSeq

Clonality

Monoclonal

Clone

3H2

Type

Monoclonal Antibody

Sequence

SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

FGF8

Host or Source

Mouse

Protein Name

Fibroblast growth factor 8 isoform E precursor [Homo sapiens]|Homo sapiens fibroblast growth factor 8 (FGF8), transcript variant E, mRNA

Gene Name URL

FGF8

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_033164

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GFI1B (His)
orb3067893 50 µg

Recombinant Human GFI1B (His)

Sign In for Pricing
View Details
GPBAR1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
22443066 1.0 µg DNA

GPBAR1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Heat Shock Factor 2 Binding Protein (HSF2BP) (NM_007031) Human Mass Spec Standard
PH301580 10 µg

Heat Shock Factor 2 Binding Protein (HSF2BP) (NM_007031) Human Mass Spec Standard

Sign In for Pricing
View Details
ERAS (NM_181532) Human Tagged ORF Clone Lentiviral Particle
RC210965L2V 200 µL

ERAS (NM_181532) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AKAP 8L Lentiviral Activation Particles (m)
sc-424811-LAC 200 µL

AKAP 8L Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
HELZ Rabbit Polyclonal Antibody (BF647)
orb1589115 100 µL

HELZ Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details