Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FDX1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Ferredoxin 1

Gene Aliases

Adrenal ferredoxin; adrenodoxin, mitochondrial; ADX; FDX; hepatoredoxin; LOH11CR1D; mitochondrial adrenodoxin.

Gene ID

2230

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_004100.1

Reactivity

Human, Mouse

Immunogen

FDX1 (NP_004100.1, 85 a.a. ~ 183 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The product of this gene is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450. This particular oxidation/reduction system is found in steroidogenic tissues, and is involved with the synthesis of bile acid and vitamin D. In addition to the expressed gene at this chromosomal locus (11q22), there are pseudogenes located on chromosomes 20 and 21. This gene product has been identified in a number of different tissues but all forms have been shown to be identical and are not tissue specific. [provided by RefSeq

Clonality

Monoclonal

Clone

10000000

Type

Monoclonal Antibody

Sequence

VGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKT

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2b Kappa

NCBI Gene Symbol

FDX1

Host or Source

Mouse

Protein Name

Adrenodoxin, mitochondrial precursor [Homo sapiens]|Homo sapiens ferredoxin 1 (FDX1), mRNA

Gene Name URL

FDX1

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_004109

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGKV2-23 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV764934 1.0 µg DNA

IGKV2-23 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Interleukin 31 Receptor A (Interleukin-31 Receptor Subunit alpha, IL-31 Receptor Subunit alpha, IL-31R Subunit alpha, IL-31R-alpha, IL-31RA, IL31RA, Cytokine Receptor-like 3, CRL3, CRL, gp130-Like Monocyte Receptor, Gp130-like Receptor, GLM-R, hGLM-R, GLM
MBS6158401-01 0.1 mL

Interleukin 31 Receptor A (Interleukin-31 Receptor Subunit alpha, IL-31 Receptor Subunit alpha, IL-31R Subunit alpha, IL-31R-alpha, IL-31RA, IL31RA, Cytokine Receptor-like 3, CRL3, CRL, gp130-Like Monocyte Receptor, Gp130-like Receptor, GLM-R, hGLM-R, GLM

Sign In for Pricing
View Details
Interleukin 31 Receptor A (Interleukin-31 Receptor Subunit alpha, IL-31 Receptor Subunit alpha, IL-31R Subunit alpha, IL-31R-alpha, IL-31RA, IL31RA, Cytokine Receptor-like 3, CRL3, CRL, gp130-Like Monocyte Receptor, Gp130-like Receptor, GLM-R, hGLM-R, GLM
MBS6158401-02 5x 0.1 mL

Interleukin 31 Receptor A (Interleukin-31 Receptor Subunit alpha, IL-31 Receptor Subunit alpha, IL-31R Subunit alpha, IL-31R-alpha, IL-31RA, IL31RA, Cytokine Receptor-like 3, CRL3, CRL, gp130-Like Monocyte Receptor, Gp130-like Receptor, GLM-R, hGLM-R, GLM

Sign In for Pricing
View Details
Goat Mannan binding lectin associated serine protease 2 ELISA kit
GTR10461953 96 Well

Goat Mannan binding lectin associated serine protease 2 ELISA kit

Sign In for Pricing
View Details
LPL Antibody
orb69149 100 µL

LPL Antibody

Sign In for Pricing
View Details
Recombinant Human Apolipoprotein L1 (APOL1)
MBS1175682-01 0.02 mg (E-Coli)

Recombinant Human Apolipoprotein L1 (APOL1)

Sign In for Pricing
View Details