Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FDPS Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Farnesyl diphosphate synthase

Gene Aliases

(2E,6E) -farnesyl diphosphate synthase; farnesyl pyrophosphate synthase; farnesyl pyrophosphate synthetase, dimethylallyltranstransferase, geranyltranstransferase; FPP synthase; FPP synthetase; FPPS; FPS; POROK9.

Gene ID

2224

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_001995.1

Reactivity

Human, Mouse

Immunogen

FDPS (NP_001995.1, 320 a.a. ~ 419 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes an enzyme that catalyzes the production of geranyl pyrophosphate and farnesyl pyrophosphate from isopentenyl pyrophosphate and dimethylallyl pyrophosphate. The resulting product, farnesyl pyrophosphate, is a key intermediate in cholesterol and sterol biosynthesis, a substrate for protein farnesylation and geranylgeranylation, and a ligand or agonist for certain hormone receptors and growth receptors. Drugs that inhibit this enzyme prevent the post-translational modifications of small GTPases and have been used to treat diseases related to bone resorption. Multiple pseudogenes have been found on chromosomes 1, 7, 14, 15, 21 and X. Multiple transcript variants encoding different isoforms have been found for this gene

Clonality

Monoclonal

Clone

3A6

Type

Monoclonal Antibody

Sequence

VTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK

Applications

Enzyme-linked immunosorbent assay

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

FDPS

Host or Source

Mouse

Protein Name

Farnesyl pyrophosphate synthase isoform a [Homo sapiens]|Homo sapiens farnesyl diphosphate synthase (FDPS), transcript variant 1, mRNA

Gene Name URL

FDPS

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_002004

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPT2 (Carnitine O-palmitoyltransferase 2, Mitochondrial, Carnitine Palmitoyltransferase II, CPT II, CPT1) (FITC)
MBS6374624-01 0.1 mL

CPT2 (Carnitine O-palmitoyltransferase 2, Mitochondrial, Carnitine Palmitoyltransferase II, CPT II, CPT1) (FITC)

Sign In for Pricing
View Details
CPT2 (Carnitine O-palmitoyltransferase 2, Mitochondrial, Carnitine Palmitoyltransferase II, CPT II, CPT1) (FITC)
MBS6374624-02 5x 0.1 mL

CPT2 (Carnitine O-palmitoyltransferase 2, Mitochondrial, Carnitine Palmitoyltransferase II, CPT II, CPT1) (FITC)

Sign In for Pricing
View Details
Tbl1xr1 ORF Vector (Rat) (pORF)
ORF077496 1.0 µg DNA

Tbl1xr1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal BTG1 Antibody (OTI7H6) [PerCP]
NBP2-70286PCP 0.1 mL

Mouse Monoclonal BTG1 Antibody (OTI7H6) [PerCP]

Sign In for Pricing
View Details
Rps6kc1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6601302 1.0 µg DNA

Rps6kc1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
SmartBase custom siRNA duplex RPC purified 50 nmols
27-6737-50 1 Each

SmartBase custom siRNA duplex RPC purified 50 nmols

Sign In for Pricing
View Details