Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHB1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

EPH receptor B1

Gene Aliases

EK6; ELK; eph tyrosine kinase 2; EPH-like kinase 6; ephrin type-B receptor 1; EPHT2; Hek6; NET; neuronally-expressed EPH-related tyrosine kinase; soluble EPHB1 variant 1; tyrosine-protein kinase receptor EPH-2.

Gene ID

2047

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_004432.1

Reactivity

Human, Mouse

Immunogen

EPHB1 (NP_004432.1, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. [provided by RefSeq

Clonality

Monoclonal

Clone

4G6

Type

Monoclonal Antibody

Sequence

ARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACT

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

EPHB1

Host or Source

Mouse

Protein Name

Ephrin type-B receptor 1 precursor [Homo sapiens]|Homo sapiens EPH receptor B1 (EPHB1), mRNA

Gene Name URL

EPHB1

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_004441

More Discoveries

Explore Other Products

Browse additional items from our catalog

OPN-a/b, NT (SPP1, BNSP, OPN, Osteopontin, Bone sialoprotein 1, Nephropontin, Secreted phosphoprotein 1, Urinary stone protein, Uropontin) (AP) discontinued
039288-AP 200 µL

OPN-a/b, NT (SPP1, BNSP, OPN, Osteopontin, Bone sialoprotein 1, Nephropontin, Secreted phosphoprotein 1, Urinary stone protein, Uropontin) (AP) discontinued

Sign In for Pricing
View Details
2,2'- (4,7-Dibromo-3-methoxynaphthalene-1,6-diyl) bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolane)
OR1102208-01 100 mg

2,2'- (4,7-Dibromo-3-methoxynaphthalene-1,6-diyl) bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolane)

Sign In for Pricing
View Details
2,2'- (4,7-Dibromo-3-methoxynaphthalene-1,6-diyl) bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolane)
OR1102208-02 250 mg

2,2'- (4,7-Dibromo-3-methoxynaphthalene-1,6-diyl) bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolane)

Sign In for Pricing
View Details
2,2'- (4,7-Dibromo-3-methoxynaphthalene-1,6-diyl) bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolane)
OR1102208-03 1 g

2,2'- (4,7-Dibromo-3-methoxynaphthalene-1,6-diyl) bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolane)

Sign In for Pricing
View Details
Recombinant Human CHSY1
orb1714477-01 50 µg

Recombinant Human CHSY1

Sign In for Pricing
View Details
Recombinant Human CHSY1
orb1714477-02 100 µg

Recombinant Human CHSY1

Sign In for Pricing
View Details