Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF2D Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Eukaryotic translation initiation factor 2D

Gene Aliases

Eukaryotic translation initiation factor 2D; HCA56; hepatocellular carcinoma-associated antigen 56; LGTN; ligatin.

Gene ID

1939

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_008824.2

Reactivity

Human, Mouse

Immunogen

EIF2D (NP_008824.2, 485 a.a. ~ 584 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a protein receptor that localizes phosphoglycoproteins within endosomes and at the cell periphery. This trafficking receptor for phosphoglycoproteins may play a role in neuroplasticity by modulating cell-cell interactions, intracellular adhesion, and protein binding at membrane surfaces. In hippocampal neurons, long-lasting down-regulation of ligatin mRNA levels occurs via post-transcriptional RNA processing following glutamate receptor activation. This protein contains single PUA and SUI1 domains and these domains may function in RNA binding and translation initiation, respectively. [provided by RefSeq

Clonality

Monoclonal

Clone

2D10

Type

Monoclonal Antibody

Sequence

KGRICPIDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQVHHLGWLLLEEYQLPRKHIQGLEKALKPGKKK

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

EIF2D

Host or Source

Mouse

Protein Name

Eukaryotic translation initiation factor 2D isoform 1 [Homo sapiens]|Homo sapiens eukaryotic translation initiation factor 2D (EIF2D), transcript variant 1, mRNA

Gene Name URL

EIF2D

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_006893

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Hnrnpa0 shRNA (UAS) - Lentiviral mouse Hnrnpa0 shRNA (UAS, iRFP) (100)
GTR15236115 1 Vial

Lentiviral mouse Hnrnpa0 shRNA (UAS) - Lentiviral mouse Hnrnpa0 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Gsn (NM_001004080) Rat Tagged Lenti ORF Clone
RR201675L3 10 µg

Gsn (NM_001004080) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Trim75 shRNA (UAS) - Lentiviral mouseTrim75 shRNA (UAS, GFP) (25)
GTR15295511 1 Vial

Lentiviral mouse Trim75 shRNA (UAS) - Lentiviral mouseTrim75 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
PDCD4 (Programmed Cell Death Protein 4, Neoplastic Transformation Inhibitor Protein, Nuclear Antigen H731-like, Protein 197/15a, H731) (AP) discontinued
131035-AP 100 µL

PDCD4 (Programmed Cell Death Protein 4, Neoplastic Transformation Inhibitor Protein, Nuclear Antigen H731-like, Protein 197/15a, H731) (AP) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CD197
sAP-1676 50 µg

Mouse Monoclonal Antibody to CD197

Sign In for Pricing
View Details
DOK2 Mouse Monoclonal Antibody [Clone 2A3]
E45M11589V-2 50 µL

DOK2 Mouse Monoclonal Antibody [Clone 2A3]

Sign In for Pricing
View Details