Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DFFA Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

DNA fragmentation factor subunit alpha

Gene Aliases

DFF1; DFF45; DFF-45; DNA fragmentation factor 45 kDa subunit; DNA fragmentation factor subunit alpha; DNA fragmentation factor, 45kDa, alpha polypeptide; ICAD; inhibitor of CAD.

Gene ID

1676

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_004392.1

Reactivity

Human, Mouse

Immunogen

DFFA (NP_004392.1, 231 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq

Clonality

Monoclonal

Clone

3A11

Type

Monoclonal Antibody

Sequence

TSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT

Applications

Enzyme-linked immunosorbent assay|Proximity ligation assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

DFFA

Host or Source

Mouse

Protein Name

DNA fragmentation factor subunit alpha isoform 1 [Homo sapiens]|Homo sapiens DNA fragmentation factor subunit alpha (DFFA), transcript variant 1, mRNA

Gene Name URL

DFFA

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_004401

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Famotidine Impurity 42
RM-F130442-01 10 mg

Famotidine Impurity 42

Sign In for Pricing
View Details
Famotidine Impurity 42
RM-F130442-02 25 mg

Famotidine Impurity 42

Sign In for Pricing
View Details
Famotidine Impurity 42
RM-F130442-03 50 mg

Famotidine Impurity 42

Sign In for Pricing
View Details
Famotidine Impurity 42
RM-F130442-04 100 mg

Famotidine Impurity 42

Sign In for Pricing
View Details
Deschloro Florfenicol
008280 2.5 mg

Deschloro Florfenicol

Sign In for Pricing
View Details
TRIM43B Adenovirus (Mouse)
47788054 1.0 mL

TRIM43B Adenovirus (Mouse)

Sign In for Pricing
View Details