Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX6B1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Cytochrome c oxidase subunit 6B1

Gene Aliases

COX VIb-1; COX6B; COXG; COXVIb1; cytochrome c oxidase subunit 6B1; cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous) ; MC4DN7.

Gene ID

1340

Accession Number

https://www.ncbi.nlm.nih.gov/protein/AAH01015

Reactivity

Human, Mouse

Immunogen

COX6B1 (AAH01015, 1 a.a. ~ 86 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq

Clonality

Monoclonal

Clone

2D3

Type

Monoclonal Antibody

Sequence

MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

COX6B1

Host or Source

Mouse

Protein Name

Cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous) [Homo sapiens]|Homo sapiens cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous), mRNA (cDNA clone MGC:3061 IMAGE:3344701), complete cds

Gene Name URL

COX6B1

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/BC001015

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF33A (NM_001278174) Human Tagged ORF Clone
RC239342 10 µg

ZNF33A (NM_001278174) Human Tagged ORF Clone

Sign In for Pricing
View Details
Di (2,4-dichloro-5-methylphenyl) disulphide
OR21485 1 Each

Di (2,4-dichloro-5-methylphenyl) disulphide

Sign In for Pricing
View Details
Human CRYbB2 (Crystallin Beta B2) ELISA Kit
MBS8804575-01 48 Well

Human CRYbB2 (Crystallin Beta B2) ELISA Kit

Sign In for Pricing
View Details
Human CRYbB2 (Crystallin Beta B2) ELISA Kit
MBS8804575-02 96 Well

Human CRYbB2 (Crystallin Beta B2) ELISA Kit

Sign In for Pricing
View Details
Human CRYbB2 (Crystallin Beta B2) ELISA Kit
MBS8804575-03 5x 96 Well

Human CRYbB2 (Crystallin Beta B2) ELISA Kit

Sign In for Pricing
View Details
Human CRYbB2 (Crystallin Beta B2) ELISA Kit
MBS8804575-04 10x 96 Well

Human CRYbB2 (Crystallin Beta B2) ELISA Kit

Sign In for Pricing
View Details