Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL5A2 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Collagen type V alpha 2 chain

Gene Aliases

AB collagen; collagen alpha-2 (V) chain; collagen, fetal membrane, A polypeptide; EDSC; EDSCL2; type V preprocollagen alpha 2 chain.

Gene ID

1290

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_000384

Reactivity

Human, Mouse

Immunogen

COL5A2 (NP_000384, 41 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes an alpha chain for one of the low abundance fibrillar collagens. Fibrillar collagen molecules are trimers that can be composed of one or more types of alpha chains. Type V collagen is found in tissues containing type I collagen and appears to regulate the assembly of heterotypic fibers composed of both type I and type V collagen. This gene product is closely related to type XI collagen and it is possible that the collagen chains of types V and XI constitute a single collagen type with tissue-specific chain combinations. Mutations in this gene are associated with Ehlers-Danlos syndrome, types I and II. [provided by RefSeq

Clonality

Monoclonal

Clone

3G11

Type

Monoclonal Antibody

Sequence

CTQNGQMYLNRDIWKPAPCQICVCDNGAILCDKIECQDVLDCADPVTPPGECCPVCSQTPGGGNTNFGRGRKGQKGEPGLVPVV

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

COL5A2

Host or Source

Mouse

Protein Name

Collagen alpha-2 (V) chain preproprotein [Homo sapiens]|Homo sapiens collagen type V alpha 2 chain (COL5A2), mRNA

Gene Name URL

COL5A2

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_000393

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYD88 (Myeloid Differentiation Factor 88) Sheep ELISA Kit
F1581 96 Tests

MYD88 (Myeloid Differentiation Factor 88) Sheep ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) SYP124 Polyclonal Antibody
MBS7182347 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) SYP124 Polyclonal Antibody

Sign In for Pricing
View Details
WNT3A Rabbit pAb
MBS8544072-01 0.1 mL

WNT3A Rabbit pAb

Sign In for Pricing
View Details
WNT3A Rabbit pAb
MBS8544072-02 0.1 mL (AF405L)

WNT3A Rabbit pAb

Sign In for Pricing
View Details
WNT3A Rabbit pAb
MBS8544072-03 0.1 mL (AF405S)

WNT3A Rabbit pAb

Sign In for Pricing
View Details
WNT3A Rabbit pAb
MBS8544072-04 0.1 mL (AF610)

WNT3A Rabbit pAb

Sign In for Pricing
View Details