Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCC2 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

ATP binding cassette subfamily C member 2

Gene Aliases

ABC30; ATP-binding cassette sub-family C member 2; ATP-binding cassette, sub-family C (CFTR/MRP), member 2; canalicular multidrug resistance protein; canalicular multispecific organic anion transporter 1; CMOAT; cMRP; DJS; MRP2; multidrug resistance-associated protein 2.

Gene ID

1244

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_000383

Reactivity

Human, Mouse

Immunogen

ABCC2 (NP_000383, 214 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia. [provided by RefSeq]

Clonality

Monoclonal

Clone

2H6

Type

Monoclonal Antibody

Sequence

LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKA

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid.// PBS, pH 7.4

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

ABCC2

Host or Source

Mouse

Protein Name

Canalicular multispecific organic anion transporter 1 [Homo sapiens]|Homo sapiens ATP binding cassette subfamily C member 2 (ABCC2), mRNA

Gene Name URL

ABCC2

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_000392

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCV1 (Recoverin, RCV1) (Biotin)
MBS6171134-01 0.1 mL

RCV1 (Recoverin, RCV1) (Biotin)

Sign In for Pricing
View Details
RCV1 (Recoverin, RCV1) (Biotin)
MBS6171134-02 5x 0.1 mL

RCV1 (Recoverin, RCV1) (Biotin)

Sign In for Pricing
View Details
ROR beta Polyclonal Antibody, Biotin Conjugated
bs-6216R-Biotin 100 µL

ROR beta Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Recombinant Human IA2/PTPRN Protein (Met687-Gln979, N-6His)
ARP5735-01 10 µg

Recombinant Human IA2/PTPRN Protein (Met687-Gln979, N-6His)

Sign In for Pricing
View Details
Recombinant Human IA2/PTPRN Protein (Met687-Gln979, N-6His)
ARP5735-02 50 µg

Recombinant Human IA2/PTPRN Protein (Met687-Gln979, N-6His)

Sign In for Pricing
View Details
Recombinant Human IA2/PTPRN Protein (Met687-Gln979, N-6His)
ARP5735-03 100 µg

Recombinant Human IA2/PTPRN Protein (Met687-Gln979, N-6His)

Sign In for Pricing
View Details