What is the catalog number for CAMLG Antibody?

The catalog number for CAMLG Antibody is OAAL00038-100UG.

What sizes are available for CAMLG Antibody?

CAMLG Antibody is available in the following size(s): 100 µg.

Is CAMLG Antibody in stock?

CAMLG Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

CAMLG Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Calcium modulating ligand

Gene Aliases

Calcium signal-modulating cyclophilin ligand; calcium-modulating cyclophilin ligand; CAML; cyclophilin B-binding protein; GET2; guided entry of tail-anchored proteins factor CAMLG.

Gene ID

819

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_001736

Reactivity

Human, Mouse

Immunogen

CAMLG (NP_001736, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin. [provided by RefSeq

Clonality

Monoclonal

Clone

3F12

Type

Monoclonal Antibody

Sequence

MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQG

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol