Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNA1F Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Calcium voltage-gated channel subunit alpha1 F

Gene Aliases

AIED; calcium channel, voltage-dependent, L type, alpha 1F subunit; Cav1.4; Cav1.4alpha1; COD3; COD4; CORDX; CORDX3; CSNB2; CSNB2A; CSNBX2; JM8; JMC8; OA2; voltage-dependent L-type calcium channel subunit alpha-1F; voltage-gated calcium channel subunit alpha Cav1.4.

Gene ID

778

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_005174

Reactivity

Human, Mouse

Immunogen

CACNA1F (NP_005174, 1878 a.a. ~ 1977 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a member of the alpha-1 subunit family; a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. The alpha-1 subunit has 24 transmembrane segments and forms the pore through which ions pass into the cell. There are multiple isoforms of each of the proteins in the complex, either encoded by different genes or the result of alternative splicing of transcripts. Alternate transcriptional splice variants of the gene described here have been observed but have not been thoroughly characterized. Mutations in this gene have been shown to cause incomplete X-linked congential stationary night blindness type 2 (CSNB2) . [provided by RefSeq

Clonality

Monoclonal

Clone

1H6

Type

Monoclonal Antibody

Sequence

LHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIADACRLTLDEMDNAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG3 Kappa

NCBI Gene Symbol

CACNA1F

Host or Source

Mouse

Protein Name

Homo sapiens calcium voltage-gated channel subunit alpha1 F (CACNA1F), transcript variant 1, mRNA|voltage-dependent L-type calcium channel subunit alpha-1F isoform 1 [Homo sapiens]

Gene Name URL

CACNA1F

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_005183

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFMBT2 Protein Vector (Human) (pPB-N-His)
PV128867 500 ng

SFMBT2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
K1614 rabbit pAb
RA32884-01 50 µL

K1614 rabbit pAb

Sign In for Pricing
View Details
K1614 rabbit pAb
RA32884-02 100 µL

K1614 rabbit pAb

Sign In for Pricing
View Details
Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Gamma (CD3g)
TRV-0003989-01 20 µL

Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Gamma (CD3g)

Sign In for Pricing
View Details
Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Gamma (CD3g)
TRV-0003989-02 100 µL

Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Gamma (CD3g)

Sign In for Pricing
View Details
Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Gamma (CD3g)
TRV-0003989-03 200 µL

Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Gamma (CD3g)

Sign In for Pricing
View Details