Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAAT Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Bile acid-CoA:amino acid N-acyltransferase

Gene Aliases

BACAT; BACD1; BAT; bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase) ; bile acid Coenzyme A: amino acid N-acyltransferase (glycine N-choloyltransferase) ; bile acid-CoA thioesterase; bile acid-CoA:amino acid N-acyltransferase; choloyl-CoA hydrolase; HCHO; long-chain fatty-acyl-CoA hydrolase.

Gene ID

570

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_001692

Reactivity

Human, Mouse

Immunogen

BAAT (NP_001692, 258 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA) . Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Clonality

Monoclonal

Clone

10000

Type

Monoclonal Antibody

Sequence

NGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFETTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLL

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

BAAT

Host or Source

Mouse

Protein Name

Bile acid-CoA:amino acid N-acyltransferase [Homo sapiens]|Homo sapiens bile acid-CoA:amino acid N-acyltransferase (BAAT), transcript variant 1, mRNA

Gene Name URL

BAAT

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_001701

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf43 AAV siRNA Pooled Vector
14203161 1.0 µg

C1orf43 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CAMK1G 3'UTR GFP Stable Cell Line
TU053422 1.0 mL

CAMK1G 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MDH2 shRNA (m) Lentiviral Particles
sc-149339-V 200 µL

MDH2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Shewanella sp. Thymidylate synthase (thyA)
MBS1025310-01 0.02 mg (E-Coli)

Recombinant Shewanella sp. Thymidylate synthase (thyA)

Sign In for Pricing
View Details
Recombinant Shewanella sp. Thymidylate synthase (thyA)
MBS1025310-02 0.02 mg (Yeast)

Recombinant Shewanella sp. Thymidylate synthase (thyA)

Sign In for Pricing
View Details
Recombinant Shewanella sp. Thymidylate synthase (thyA)
MBS1025310-03 0.1 mg (E-Coli)

Recombinant Shewanella sp. Thymidylate synthase (thyA)

Sign In for Pricing
View Details