Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AUH Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

AU RNA binding methylglutaconyl-CoA hydratase

Gene Aliases

3-methylglutaconyl-CoA hydratase; AU RNA binding protein/enoyl-CoA hydratase; AU RNA-binding protein/enoyl-Coenzyme A hydratase; AU-binding protein/Enoyl-CoA hydratase; AU-specific RNA-binding enoyl-CoA hydratase; itaconyl-CoA hydratase; methylglutaconyl-CoA hydratase, mitochondrial.

Gene ID

549

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_001689

Reactivity

Human, Mouse

Immunogen

AUH (NP_001689, 44 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

AU-specific RNA-binding enoyl-CoA hydratase (AUH) protein binds to the AU-rich element (ARE), a common element found in the 3' UTR of rapidly decaying mRNA such as c-fos, c-myc and granulocyte/ macrophage colony stimulating factor. ARE elements are involved in directing RNA to rapid degradation and deadenylation. AUH is also homologous to enol-CoA hydratase, an enzyme involved in fatty acid degradation, and has been shown to have intrinsic hydratase enzymatic activity. AUH is thus a bifunctional chimera between RNA binding and metabolic enzyme activity. A possible subcellular localization in the mitochondria has been demonstrated for the mouse homolog of this protein which shares 92% identity with the human protein. It has been suggested that AUH may have a novel role as a mitochondrial located AU-binding protein. Human AUH is expressed as a single mRNA species of 1.8 kb, and translated as a 40-kDa precursor protein which is subsequently processed to a 32-kDa mature form. [provided by RefSeq

Clonality

Monoclonal

Clone

2G12

Type

Monoclonal Antibody

Sequence

RAGPAIWAQGWVPAAGGPAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPG

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

AUH

Host or Source

Mouse

Protein Name

Homo sapiens AU RNA binding methylglutaconyl-CoA hydratase (AUH), transcript variant 1, mRNA|methylglutaconyl-CoA hydratase, mitochondrial isoform 1 precursor [Homo sapiens]

Gene Name URL

AUH

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_001698

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Arginine Vasopressin Receptor 2 (AVPR2) ELISA Kit
MBS9347096 Inquire

Fish Arginine Vasopressin Receptor 2 (AVPR2) ELISA Kit

Sign In for Pricing
View Details
Rat GM-CSF (Granulocyte-Macrophage Colony Stimulating Factor) ValidElisa Kit
EK342123 96 Well

Rat GM-CSF (Granulocyte-Macrophage Colony Stimulating Factor) ValidElisa Kit

Sign In for Pricing
View Details
NANOG Antibody - N-terminal region : HRP (P100728_P050-HRP)
P100728_P050-HRP 100 µL

NANOG Antibody - N-terminal region : HRP (P100728_P050-HRP)

Sign In for Pricing
View Details
KCNJ18, NT (KCNJ18, Inward rectifier potassium channel 18, Inward rectifier K (+) channel Kir2.6, Potassium channel, inwardly rectifying subfamily J member 18) (MaxLight 490) discontinued
037327-ML490 100 µL

KCNJ18, NT (KCNJ18, Inward rectifier potassium channel 18, Inward rectifier K (+) channel Kir2.6, Potassium channel, inwardly rectifying subfamily J member 18) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Mouse Max-like protein X, Mlx ELISA KIT
ELI-45572m 96 Tests

Mouse Max-like protein X, Mlx ELISA KIT

Sign In for Pricing
View Details
PI3KC3 Antibody (N-term)
MBS9201639-01 0.08 mL

PI3KC3 Antibody (N-term)

Sign In for Pricing
View Details