Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AUH Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

AU RNA binding methylglutaconyl-CoA hydratase

Gene Aliases

3-methylglutaconyl-CoA hydratase; AU RNA binding protein/enoyl-CoA hydratase; AU RNA-binding protein/enoyl-Coenzyme A hydratase; AU-binding protein/Enoyl-CoA hydratase; AU-specific RNA-binding enoyl-CoA hydratase; itaconyl-CoA hydratase; methylglutaconyl-CoA hydratase, mitochondrial.

Gene ID

549

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_001689

Reactivity

Human, Mouse

Immunogen

AUH (NP_001689, 44 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

AU-specific RNA-binding enoyl-CoA hydratase (AUH) protein binds to the AU-rich element (ARE), a common element found in the 3' UTR of rapidly decaying mRNA such as c-fos, c-myc and granulocyte/ macrophage colony stimulating factor. ARE elements are involved in directing RNA to rapid degradation and deadenylation. AUH is also homologous to enol-CoA hydratase, an enzyme involved in fatty acid degradation, and has been shown to have intrinsic hydratase enzymatic activity. AUH is thus a bifunctional chimera between RNA binding and metabolic enzyme activity. A possible subcellular localization in the mitochondria has been demonstrated for the mouse homolog of this protein which shares 92% identity with the human protein. It has been suggested that AUH may have a novel role as a mitochondrial located AU-binding protein. Human AUH is expressed as a single mRNA species of 1.8 kb, and translated as a 40-kDa precursor protein which is subsequently processed to a 32-kDa mature form. [provided by RefSeq

Clonality

Monoclonal

Clone

2G12

Type

Monoclonal Antibody

Sequence

RAGPAIWAQGWVPAAGGPAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPG

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

AUH

Host or Source

Mouse

Protein Name

Homo sapiens AU RNA binding methylglutaconyl-CoA hydratase (AUH), transcript variant 1, mRNA|methylglutaconyl-CoA hydratase, mitochondrial isoform 1 precursor [Homo sapiens]

Gene Name URL

AUH

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_001698

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-human IFN-γ mAb (7-B6-1), biotin
3420-6-250 250 µg

Anti-human IFN-γ mAb (7-B6-1), biotin

Sign In for Pricing
View Details
Human MAP3K12 binding inhibitory protein 1 (MBIP) (NM_001144891) AAV Particle
RC227248A1V 250 µL

Human MAP3K12 binding inhibitory protein 1 (MBIP) (NM_001144891) AAV Particle

Sign In for Pricing
View Details
AGPAT1 Protein Vector (Human) (pPB-N-His)
PV000990 500 ng

AGPAT1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CIZ1 Protein Vector (Mouse) (pPB-C-His)
PV165686 500 ng

CIZ1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
DAK Antibody
E11-11155C 100 µg

DAK Antibody

Sign In for Pricing
View Details
Phospho-Ephrin B (Tyr324 + Tyr329) Rabbit Polyclonal Antibody
orb5163-01 50 μL

Phospho-Ephrin B (Tyr324 + Tyr329) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details