Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP7B Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

ATPase copper transporting beta

Gene Aliases

ATPase, Cu (2+) - transporting, beta polypeptide; ATPase, Cu++ transporting, beta polypeptide; copper pump 2; copper-transporting ATPase 2; copper-transporting protein ATP7B; PWD; WC1; WD; Wilson disease-associated protein; WND.

Gene ID

540

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_000044

Reactivity

Human, Mouse

Immunogen

ATP7B (NP_000044, 1372 a.a. ~ 1465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein functions as a monomer, exporting copper out of the cells, such as the efflux of hepatic copper into the bile. Alternate transcriptional splice variants, encoding different isoforms with distinct cellular localizations, have been characterized. Mutations in this gene have been associated with Wilson disease (WD) . [provided by RefSeq

Clonality

Monoclonal

Clone

3A12

Type

Monoclonal Antibody

Sequence

QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

ATP7B

Host or Source

Mouse

Protein Name

Copper-transporting ATPase 2 isoform a [Homo sapiens]|Homo sapiens ATPase copper transporting beta (ATP7B), transcript variant 1, mRNA

Gene Name URL

ATP7B

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_000053

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nmbr 3'UTR Lenti-reporter-Luc Vector
31937084 1.0 µg

Nmbr 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human anti-human PD-L1 mAb
E4A09L05-50 50 µg

Human anti-human PD-L1 mAb

Sign In for Pricing
View Details
Gns 3'UTR GFP Stable Cell Line
TU158890 1.0 mL

Gns 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TAL1 Antibody / T-cell acute lymphocytic leukemia protein 1
V8107-20UG 20 µg

TAL1 Antibody / T-cell acute lymphocytic leukemia protein 1

Sign In for Pricing
View Details
CYP24A1 sgRNA CRISPR Lentivector (Human) (Target 3)
K0555904 1.0 µg DNA

CYP24A1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
AH1 peptide (gp70 H2-Ld-restricted epitope) (SPSYVYHQF, >95%)
AH11-P-10 10 mg

AH1 peptide (gp70 H2-Ld-restricted epitope) (SPSYVYHQF, >95%)

Sign In for Pricing
View Details