Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCC6 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

ATP binding cassette subfamily C member 6

Gene Aliases

ABC34; anthracycline resistance-associated protein; ARA; ATP-binding cassette sub-family C member 6; ATP-binding cassette, sub-family C (CFTR/MRP), member 6; EST349056; GACI2; MLP1; MOATE; MOAT-E; MRP6; multidrug resistance-associated protein 6; multi-specific organic anion transporter E; PXE; PXE1; URG7; URG7 protein.

Gene ID

368

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_001162

Reactivity

Human, Mouse

Immunogen

ABCC6 (NP_001162, 831 a.a. ~ 930 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq

Clonality

Monoclonal

Clone

1000000

Type

Monoclonal Antibody

Sequence

IAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRV

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2b Kappa

NCBI Gene Symbol

ABCC6

Host or Source

Mouse

Protein Name

Homo sapiens ATP binding cassette subfamily C member 6 (ABCC6), transcript variant 1, mRNA|multidrug resistance-associated protein 6 isoform 1 [Homo sapiens]

Gene Name URL

ABCC6

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_001171

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIF4GD Polyclonal Antibody
A59818-050 50 µL

MIF4GD Polyclonal Antibody

Sign In for Pricing
View Details
Heat Shock Protein 101 (Hsp101/ClpB- C-terminal)
MBS620929-01 0.2 mL

Heat Shock Protein 101 (Hsp101/ClpB- C-terminal)

Sign In for Pricing
View Details
Heat Shock Protein 101 (Hsp101/ClpB- C-terminal)
MBS620929-02 5x 0.2 mL

Heat Shock Protein 101 (Hsp101/ClpB- C-terminal)

Sign In for Pricing
View Details
GCSF Receptor Rabbit pAb
E47R2574 100 µL

GCSF Receptor Rabbit pAb

Sign In for Pricing
View Details
SLC39A10 (NM_020342) Human Tagged Lenti ORF Clone
RC219614L1 10 µg

SLC39A10 (NM_020342) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CHO Monoclonal TIGIT Antibody (domvanalimab) - Humanized - (Dry Ice)
NBP3-28047-50ug 50 µg

CHO Monoclonal TIGIT Antibody (domvanalimab) - Humanized - (Dry Ice)

Sign In for Pricing
View Details