Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVRL1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Activin A receptor like type 1

Gene Aliases

Activin A receptor type II-like 1; activin A receptor type IL; activin A receptor, type II-like kinase 1; ACVRLK1; ALK1; ALK-1; HHT; HHT2; ORW2; serine/threonine-protein kinase receptor R3; SKR3; TGF-B superfamily receptor type I; TSR-I.

Gene ID

94

Accession Number

https://www.ncbi.nlm.nih.gov/protein/AAH42637

Reactivity

Human, Mouse

Immunogen

ACVRL1 (AAH42637, 22 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2. [provided by RefSeq

Clonality

Monoclonal

Clone

5B1

Type

Monoclonal Antibody

Sequence

DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

ACVRL1

Host or Source

Mouse

Protein Name

Activin A receptor type II-like 1 [Homo sapiens]|Homo sapiens activin A receptor type II-like 1, mRNA (cDNA clone MGC:34522 IMAGE:5179243), complete cds

Gene Name URL

ACVRL1

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/BC042637

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Assurance Grade Phosphorus for AA and ICP 1000 ug/mL (1000 PPM) 30mL in H2O
PLP9-2M 30 mL

Assurance Grade Phosphorus for AA and ICP 1000 ug/mL (1000 PPM) 30mL in H2O

Sign In for Pricing
View Details
Rat Nucb1 ELISA Kit
EF019092 96 Tests

Rat Nucb1 ELISA Kit

Sign In for Pricing
View Details
Anti-TIF1 gamma/TRIM33 Antibody Picoband® (Dylight488 Conjugate)
PB9836-Dylight488 100 µg

Anti-TIF1 gamma/TRIM33 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
JAK1 Peptide
AF6701-BP 1 mg

JAK1 Peptide

Sign In for Pricing
View Details
Ptcd3 (NM_027275) Mouse Tagged Lenti ORF Clone
MR216202L3 10 µg

Ptcd3 (NM_027275) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
3,5-Dimethyl-1-benzothiophene-2-carboxylic acid
GAA17920-01 100 mg

3,5-Dimethyl-1-benzothiophene-2-carboxylic acid

Sign In for Pricing
View Details