Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF13 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Kruppel like factor 13

Gene Aliases

Basic transcription element binding protein 3; Basic transcription element-binding protein 3; BTEB3; BTE-binding protein 3; FKLF2; Krueppel-like factor 13; novel Sp1-like zinc finger transcription factor 1; NSLP1; RANTES factor of late activated T lymphocytes-1; RANTES factor of late activated T-lymphocytes 1; RFLAT1; RFLAT-1; transcription factor BTEB3; transcription factor NSLP1.

Gene ID

51621

Swiss Prot

Q9Y2Y9

Reactivity

Human|Mouse

Immunogen

The antiserum was produced against synthesized peptide derived from human KLF13 around the non-acetylation site of Lys166.

Target

Represses transcription by binding to the BTE site, a GC-rich DNA element, in competition with the activator SP1. It also represses transcription by interacting with the corepressor Sin3A and HDAC1. Activates RANTES expression in T-cells.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LEPEREPGPAGSGEPGLRQRVRRGRSRADLESPQRKHKCHYAGCEKVYGK

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

31 kDa

Specificity

KLF13 Antibody detects endogenous levels of KLF13166 protein.

NCBI Gene Symbol

KLF13

Host or Source

Rabbit

Protein Name

Krueppel-like factor 13

Gene Name URL

KLF13

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Yersinia pestis bv. Antiqua Autoinducer 2 import ATP-binding protein LsrA (lsrA), partial
MBS1185987 Inquire

Recombinant Yersinia pestis bv. Antiqua Autoinducer 2 import ATP-binding protein LsrA (lsrA), partial

Sign In for Pricing
View Details
FUCA1 (Alpha-L-fucosidase 1, Alpha-L-fucosidase I, Alpha-L-fucoside Fucohydrolase 1, FUCA, Nbla10230, Tissue alpha-L-fucosidase) (HRP) discontinued
F9165-50B-HRP 200 µL

FUCA1 (Alpha-L-fucosidase 1, Alpha-L-fucosidase I, Alpha-L-fucoside Fucohydrolase 1, FUCA, Nbla10230, Tissue alpha-L-fucosidase) (HRP) discontinued

Sign In for Pricing
View Details
14-3-3 Theta Rabbit mAb (AMR13141N)
AMR13141N-01 50 µL

14-3-3 Theta Rabbit mAb (AMR13141N)

Sign In for Pricing
View Details
14-3-3 Theta Rabbit mAb (AMR13141N)
AMR13141N-02 100 µL

14-3-3 Theta Rabbit mAb (AMR13141N)

Sign In for Pricing
View Details
14-3-3 Theta Rabbit mAb (AMR13141N)
AMR13141N-03 200 µL

14-3-3 Theta Rabbit mAb (AMR13141N)

Sign In for Pricing
View Details
GLYATL1P2 3'UTR Luciferase Stable Cell Line
TU008936 1.0 mL

GLYATL1P2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details