Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H4 Antibody

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

H4 clustered histone 1|H4 clustered histone 11|H4 clustered histone 12|H4 clustered histone 13|H4 clustered histone 14|H4 clustered histone 15|H4 clustered histone 2

Gene Aliases

DJ160A22.1; dJ160A22.2; dJ221C16.1; dJ221C16.9; FO108; H4; H4 histone family, member A; H4 histone family, member B; H4 histone family, member C; H4 histone family, member D; H4 histone family, member E; H4 histone family, member G; H4 histone family, member H; H4 histone family, member I; H4 histone family, member J; H4 histone family, member K; H4 histone family, member M; H4 histone family, member N; H4 histone, family 2; H4.k; H4/b; H4/c; H4/d; H4/e; H4/g; H4/h; H4/I; H4/j; H4/k; H4/m; H4/n; H4/o; H4/p; H4-16; H4C1; H4C11; H4C12; H4C13; H4C14; H4C15; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4F2iii; H4F2iv; H4FA; H4FB; H4FC; H4FD; H4FE; H4FG; H4FH; H4FI; H4FJ; H4FK; H4FM; H4FN; H4M; HIST1H4A; HIST1H4B; HIST1H4C; HIST1H4D; HIST1H4E; HIST1H4F; HIST1H4H; HIST1H4I; HIST1H4J; HIST1H4K; HIST1H4L; HIST2H4; HIST2H4A; HIST2H4B; HIST4H4; histone 1, H4a; histone 1, H4b; histone 1, H4c; histone 1, H4d; histone 1, H4e; histone 1, H4f; histone 1, H4h; histone 1, H4i; histone 1, H4j; histone 1, H4k; histone 1, H4l; histone 2, H4a; histone 2, H4b; Histone 4 family, member M; histone 4, H4; histone cluster 1 H4 family member a; histone cluster 1 H4 family member b; histone cluster 1 H4 family member c; histone cluster 1 H4 family member d; histone cluster 1 H4 family member e; histone cluster 1 H4 family member f; histone cluster 1 H4 family member h; histone cluster 1 H4 family member i; histone cluster 1 H4 family member j; histone cluster 1 H4 family member k; histone cluster 1 H4 family member l; histone cluster 1, H4a; histone cluster 1, H4b; histone cluster 1, H4c; histone cluster 1, H4d; histone cluster 1, H4e; histone cluster 1, H4f; histone cluster 1, H4h; histone cluster 1, H4i; histone cluster 1, H4j; histone cluster 1, H4k; histone cluster 1, H4l; histone cluster 2 H4 family member a; histone cluster 2 H4 family member b; histone cluster 2, H4a; histone cluster 2, H4b; histone cluster 4 H4; histone family member; histone H4; histone IV, family 2.

Gene ID

121504|554313|8294|8359|8360|8361|8362|8363|8364|8365|8366|8367|8368|8370

Swiss Prot

P62805

Reactivity

Human|Monkey|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human Histone H4.

Target

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGL

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Format

Liquid.// PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.

Reconstitution

-20°C

Molecular Weight

11 kDa

Notes

Formerly GWB-ASF156

Fragment

IgG

Specificity

Histone H4 Antibody detects endogenous levels of total Histone H4 protein.

NCBI Gene Symbol

H4-16|H4C1|H4C11|H4C12|H4C13|H4C14|H4C15|H4C2|H4C3|H4C4|H4C5|H4C6|H4C8|H4C9

Host or Source

Rabbit

Protein Name

Histone H4

Gene Name URL

H4-16|H4C1|H4C11|H4C12|H4C13|H4C14|H4C15|H4C2|H4C3|H4C4|H4C5|H4C6|H4C8|H4C9

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD27 Over-expression Lysate Product
GWB-85FBF8 0.1 mg

CD27 Over-expression Lysate Product

Sign In for Pricing
View Details
Lpin1 protein Rabbit Polyclonal Antibody (Cy5.5)
orb1053733 100 µL

Lpin1 protein Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Recombinant Thermotoga lettingae Acetate kinase (ackA)
MBS1021556-01 0.02 mg (E-Coli)

Recombinant Thermotoga lettingae Acetate kinase (ackA)

Sign In for Pricing
View Details
Recombinant Thermotoga lettingae Acetate kinase (ackA)
MBS1021556-02 0.02 mg (Yeast)

Recombinant Thermotoga lettingae Acetate kinase (ackA)

Sign In for Pricing
View Details
Recombinant Thermotoga lettingae Acetate kinase (ackA)
MBS1021556-03 0.1 mg (E-Coli)

Recombinant Thermotoga lettingae Acetate kinase (ackA)

Sign In for Pricing
View Details
Recombinant Thermotoga lettingae Acetate kinase (ackA)
MBS1021556-04 0.1 mg (Yeast)

Recombinant Thermotoga lettingae Acetate kinase (ackA)

Sign In for Pricing
View Details