Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P53 Antibody (Acetyl-Lys386)

Product Specifications

CAS Number

9007-83-4

Gene Name

Tumor protein p53

Gene Aliases

Antigen NY-CO-13; BCC7; BMFS5; cellular tumor antigen p53; LFS1; mutant tumor protein 53; P53; p53 tumor suppressor; phosphoprotein p53; transformation-related protein 53; TRP53; tumor protein 53; Tumor suppressor p53; tumor supressor p53.

Gene ID

7157

Swiss Prot

P04637

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human p53 around the acetylated site of Lys386.

Target

Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. In cooperation with mitochondrial PPIF is involved in activating oxidative stress-induced necrosis; the function is largely independent of transcription. Induces the transcription of long intergenic non-coding RNA p21 (lincRNA-p21) and lincRNA-Mkln1. LincRNA-p21 participates in TP53-dependent transcriptional repression leading to apoptosis and seem to have to effect on cell-cycle regulation. Implicated in Notch signaling cross-over. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression. Isoform 2 enhances the transactivation activity of isoform 1 from some but not all TP53-inducible promoters. Isoform 4 suppresses transactivation activity and impairs growth suppression mediated by isoform 1. Isoform 7 inhibits isoform 1-mediated apoptosis. Regulates the circadian clock by repressing CLOCK-ARNTL/BMAL1-mediated transcriptional activation of PER2 (PubMed:24051492) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using acetylated peptide. The antibody against non-acetylated peptide was removed by chromatography using corresponding non-acetylated peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

43 kDa

Notes

Formerly GWB-ASF143

Specificity

P53 (Acetyl-Lys386) Antibody detects endogenous levels of total p53 protein only when acetylated at Lys386.

NCBI Gene Symbol

TP53

Host or Source

Rabbit

Protein Name

Cellular tumor antigen p53

Gene Name URL

TP53

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCGB3A1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV649653 1.0 µg DNA

SCGB3A1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Anti-CBS Antibody (7N696)
MF-0068809-01 50 µL

Anti-CBS Antibody (7N696)

Sign In for Pricing
View Details
Anti-CBS Antibody (7N696)
MF-0068809-02 100 µL

Anti-CBS Antibody (7N696)

Sign In for Pricing
View Details
Trypsin (PRSS3) (NM_007343) Human Over-expression Lysate
LC429349 20 µg

Trypsin (PRSS3) (NM_007343) Human Over-expression Lysate

Sign In for Pricing
View Details
HMBOX1 Rabbit Polyclonal Antibody
TA372736 100 µL

HMBOX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SCN4A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
43183111 3x 1.0 µg

SCN4A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details