What is the catalog number for Histone H4 Antibody (Acetyl-Lys16)?

The catalog number for Histone H4 Antibody (Acetyl-Lys16) is OAAF08184-100UG.

What sizes are available for Histone H4 Antibody (Acetyl-Lys16)?

Histone H4 Antibody (Acetyl-Lys16) is available in the following size(s): 100 µg.

Is Histone H4 Antibody (Acetyl-Lys16) in stock?

Histone H4 Antibody (Acetyl-Lys16) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Histone H4 Antibody (Acetyl-Lys16)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Gene Aliases

DJ160A22.1; dJ160A22.2; dJ221C16.1; dJ221C16.9; FO108; G13P1; H4; H4 histone family, member A; H4 histone family, member B; H4 histone family, member C; H4 histone family, member D; H4 histone family, member E; H4 histone family, member G; H4 histone family, member H; H4 histone family, member I; H4 histone family, member J; H4 histone family, member K; H4 histone family, member M; H4 histone family, member N; H4 histone, family 2; H4.k; H4/b; H4/c; H4/d; H4/e; H4/g; H4/h; H4/I; H4/j; H4/k; H4/m; H4/n; H4/o; H4/p; H4-16; H4C1; H4C11; H4C12; H4C13; H4C14; H4C15; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4F2iii; H4F2iv; H4FA; H4FB; H4FC; H4FD; H4FE; H4FG; H4FH; H4FI; H4FJ; H4FK; H4FM; H4FN; H4M; HIST1H4A; HIST1H4B; HIST1H4C; HIST1H4D; HIST1H4E; HIST1H4F; HIST1H4H; HIST1H4I; HIST1H4J; HIST1H4K; HIST1H4L; HIST2H4; HIST2H4A; HIST2H4B; HIST4H4; histone 1, H4a; histone 1, H4b; histone 1, H4c; histone 1, H4d; histone 1, H4e; histone 1, H4f; histone 1, H4h; histone 1, H4i; histone 1, H4j; histone 1, H4k; histone 1, H4l; histone 2, H4a; histone 2, H4b; Histone 4 family, member M; histone 4, H4; histone cluster 1 H4 family member a; histone cluster 1 H4 family member b; histone cluster 1 H4 family member c; histone cluster 1 H4 family member d; histone cluster 1 H4 family member e; histone cluster 1 H4 family member f; histone cluster 1 H4 family member h; histone cluster 1 H4 family member i; histone cluster 1 H4 family member j; histone cluster 1 H4 family member k; histone cluster 1 H4 family member l; histone cluster 1, H4a; histone cluster 1, H4b; histone cluster 1, H4c; histone cluster 1, H4d; histone cluster 1, H4e; histone cluster 1, H4f; histone cluster 1, H4h; histone cluster 1, H4i; histone cluster 1, H4j; histone cluster 1, H4k; histone cluster 1, H4l; histone cluster 2 H4 family member a; histone cluster 2 H4 family member b; histone cluster 2, H4a; histone cluster 2, H4b; histone cluster 4 H4; histone family member; histone H4; histone IV, family 2; IFI56P; IFIT1P; II56P; interferon-induced protein 56 pseudogene; interferon-induced protein with tetratricopeptide repeats 1, pseudogene.

Gene ID

121504|554313|8294|8359|8360|8361|8362|8363|8364|8365|8366|8367|8368|8370|8373

Swiss Prot

P62805

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human Histone H4 around the acetylated site of Lys16.

Target

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGL

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using acetylated peptide. The antibody against non-acetylated peptide was removed by chromatography using corresponding non-acetylated peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol