Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H4 Antibody (Acetyl-Lys8)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

H4 clustered histone 1|H4 clustered histone 11|H4 clustered histone 12|H4 clustered histone 13|H4 clustered histone 14|H4 clustered histone 15|H4 clustered histone 2

Gene Aliases

DJ160A22.1; dJ160A22.2; dJ221C16.1; dJ221C16.9; FO108; H4; H4 histone family, member A; H4 histone family, member B; H4 histone family, member C; H4 histone family, member D; H4 histone family, member E; H4 histone family, member G; H4 histone family, member H; H4 histone family, member I; H4 histone family, member J; H4 histone family, member K; H4 histone family, member M; H4 histone family, member N; H4 histone, family 2; H4.k; H4/b; H4/c; H4/d; H4/e; H4/g; H4/h; H4/I; H4/j; H4/k; H4/m; H4/n; H4/o; H4/p; H4-16; H4C1; H4C11; H4C12; H4C13; H4C14; H4C15; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4F2iii; H4F2iv; H4FA; H4FB; H4FC; H4FD; H4FE; H4FG; H4FH; H4FI; H4FJ; H4FK; H4FM; H4FN; H4M; HIST1H4A; HIST1H4B; HIST1H4C; HIST1H4D; HIST1H4E; HIST1H4F; HIST1H4H; HIST1H4I; HIST1H4J; HIST1H4K; HIST1H4L; HIST2H4; HIST2H4A; HIST2H4B; HIST4H4; histone 1, H4a; histone 1, H4b; histone 1, H4c; histone 1, H4d; histone 1, H4e; histone 1, H4f; histone 1, H4h; histone 1, H4i; histone 1, H4j; histone 1, H4k; histone 1, H4l; histone 2, H4a; histone 2, H4b; Histone 4 family, member M; histone 4, H4; histone cluster 1 H4 family member a; histone cluster 1 H4 family member b; histone cluster 1 H4 family member c; histone cluster 1 H4 family member d; histone cluster 1 H4 family member e; histone cluster 1 H4 family member f; histone cluster 1 H4 family member h; histone cluster 1 H4 family member i; histone cluster 1 H4 family member j; histone cluster 1 H4 family member k; histone cluster 1 H4 family member l; histone cluster 1, H4a; histone cluster 1, H4b; histone cluster 1, H4c; histone cluster 1, H4d; histone cluster 1, H4e; histone cluster 1, H4f; histone cluster 1, H4h; histone cluster 1, H4i; histone cluster 1, H4j; histone cluster 1, H4k; histone cluster 1, H4l; histone cluster 2 H4 family member a; histone cluster 2 H4 family member b; histone cluster 2, H4a; histone cluster 2, H4b; histone cluster 4 H4; histone family member; histone H4; histone IV, family 2; TGD.

Gene ID

121504|554313|8294|8359|8360|8361|8362|8363|8364|8365|8366|8367|8368|8370|8371

Swiss Prot

P62805

Reactivity

Human|Monkey|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human Histone H4 around the acetylated site of Lys8.

Target

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGL

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using acetylated peptide. The antibody against non-acetylated peptide was removed by chromatography using corresponding non-acetylated peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

11 kDa

Notes

Formerly GWB-ASF138

Specificity

Histone H4 (Acetyl-Lys8) Antibody detects endogenous levels of total Histone H4 protein only when acetylated at Lys8.

NCBI Gene Symbol

H4-16|H4C1|H4C11|H4C12|H4C13|H4C14|H4C15|H4C2|H4C3|H4C4|H4C5|H4C6|H4C8|H4C9|HDLDT1

Host or Source

Rabbit

Protein Name

Histone H4

Gene Name URL

H4-16|H4C1|H4C11|H4C12|H4C13|H4C14|H4C15|H4C2|H4C3|H4C4|H4C5|H4C6|H4C8|H4C9|HDLDT1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARSL Human Pre-designed siRNA Set A
HY-RS01043 1 Set

ARSL Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rat D2D ELISA Kit
EF017678 96 Tests

Rat D2D ELISA Kit

Sign In for Pricing
View Details
Rat WS Penis Total Protein
RT-416-WS 0.5 mg

Rat WS Penis Total Protein

Sign In for Pricing
View Details
RFP Expressing Monkey Primary Esophageal Fibroblasts
NHFF-1123-HX381 Each

RFP Expressing Monkey Primary Esophageal Fibroblasts

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) OMA1 Polyclonal Antibody
MBS7158315 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) OMA1 Polyclonal Antibody

Sign In for Pricing
View Details
Human GATA4 protein
orb753371-01 50 µg

Human GATA4 protein

Sign In for Pricing
View Details