Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H3 Antibody (Acetyl-Lys27)

Product Specifications

CAS Number

9007-83-4

Gene Name

H3 clustered histone 1|H3 clustered histone 10|H3 clustered histone 11|H3 clustered histone 12|H3 clustered histone 13|H3 clustered histone 14|H3 clustered histone 16

Gene Aliases

H3; H3 histone family member 3A; H3 histone family member 3B; H3 histone family, member A; H3 histone family, member B; H3 histone family, member C; H3 histone family, member D; H3 histone family, member F; H3 histone family, member H; H3 histone family, member I; H3 histone family, member J; H3 histone family, member K; H3 histone family, member L; H3 histone family, member M; H3 histone, family 2; H3 histone, family 3A; H3 histone, family 3B (H3.3B) ; H3.1; H3.2; H3.3A; H3.3B; H3.f; H3/A; H3/b; H3/c; H3/d; H3/f; H3/h; H3/i; H3/j; H3/k; H3/l; H3/M; H3/n; H3/o; H3-3A; H3-3B; H3C1; H3C10; H3C11; H3C12; H3C13; H3C14; H3C15; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3-clustered histone 13; H3-clustered histone 14; H3-clustered histone 15; H3F1K; H3F2; H3F3; H3F3A; H3F3B; H3FA; H3FB; H3FC; H3FD; H3FF; H3FH; H3FI; H3FJ; H3FK; H3FL; H3FM; H3FN; HIST1H3A; HIST1H3B; HIST1H3C; HIST1H3D; HIST1H3E; HIST1H3F; HIST1H3G; HIST1H3H; HIST1H3I; HIST1H3J; HIST2H3A; HIST2H3C; HIST2H3D; histone 1, H3a; histone 1, H3b; histone 1, H3c; histone 1, H3d; histone 1, H3e; histone 1, H3f; histone 1, H3g; histone 1, H3h; histone 1, H3i; histone 1, H3j; histone 2, H3a; histone 2, H3c; histone 2, H3d; histone cluster 1 H3 family member a; histone cluster 1 H3 family member b; histone cluster 1 H3 family member c; histone cluster 1 H3 family member d; histone cluster 1 H3 family member e; histone cluster 1 H3 family member f; histone cluster 1 H3 family member g; histone cluster 1 H3 family member h; histone cluster 1 H3 family member i; histone cluster 1 H3 family member j; histone cluster 1, H3a; histone cluster 1, H3b; histone cluster 1, H3c; histone cluster 1, H3d; histone cluster 1, H3e; histone cluster 1, H3f; histone cluster 1, H3g; histone cluster 1, H3h; histone cluster 1, H3i; histone cluster 1, H3j; histone cluster 2 H3 family member a; histone cluster 2 H3 family member c; histone cluster 2 H3 family member d; histone cluster 2, H3a; histone cluster 2, H3c; histone cluster 2, H3d; histone H3.1; histone H3.2; histone H3.3; histone H3/a; histone H3/b; histone H3/c; histone H3/d; histone H3/f; histone H3/h; histone H3/i; histone H3/j; histone H3/k; histone H3/l; histone H3/m; histone H3/o.

Gene ID

126961|3020|3021|3025|333932|653604|8350|8351|8352|8353|8354|8355|8356|8357|8358|8968

Swiss Prot

P68431|P84243|Q71DI3

Reactivity

Human|Monkey|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human Histone H3 around the acetylated site of Lys27.

Target

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.|Variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in active genes. Constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. Deposited at sites of nucleosomal displacement throughout transcribed genes, suggesting that it represents an epigenetic imprint of transcriptionally active chromatin. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

STGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Immunoprecipitation|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using acetylated peptide. The antibody against non-acetylated peptide was removed by chromatography using corresponding non-acetylated peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

15 kDa

Notes

Formerly GWB-ASF136

Specificity

Histone H3 (Acetyl-Lys27) Antibody detects endogenous levels of total Histone H3 protein only when acetylated at Lys27.

NCBI Gene Symbol

H3-3A|H3-3B|H3C1|H3C10|H3C11|H3C12|H3C13|H3C14|H3C15|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8|HABP1

Host or Source

Rabbit

Protein Name

Histone H3.1|Histone H3.2|Histone H3.3

Gene Name URL

H3-3A|H3-3B|H3C1|H3C10|H3C11|H3C12|H3C13|H3C14|H3C15|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8|HABP1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Parotid gland
CS641111 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details
Tissue FFPE Sections, Pancreas
CS710223 5x 5 µm

Tissue FFPE Sections, Pancreas

Sign In for Pricing
View Details
PTOP (ACD) Human Gene Knockout Kit (CRISPR)
KN204381LP 1 Kit

PTOP (ACD) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MTOR Rabbit Monoclonal Antibody [Clone ID: 24GB200]
TA424969 100 µL

MTOR Rabbit Monoclonal Antibody [Clone ID: 24GB200]

Sign In for Pricing
View Details
2,6-Dichloro-4-nitroanisole
TRC-D438480-500MG 500 mg

2,6-Dichloro-4-nitroanisole

Sign In for Pricing
View Details
SPATA18 (NM_145263) Human Recombinant Protein
TP305544L 1 mg

SPATA18 (NM_145263) Human Recombinant Protein

Sign In for Pricing
View Details