Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H2B Antibody (Acetyl-Lys5)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

H2B.S histone 1|histone H2B type F-S-like

Gene Aliases

H2B histone family member S; H2B/s; H2BFS; histone H2B type F-S; histone H2B type F-S-like; histone H2B.s; histone protein.

Gene ID

102724334|54145

Swiss Prot

P57053

Reactivity

Human|Mouse

Immunogen

The antiserum was produced against synthesized peptide derived from human Histone H2B around the acetylated site of Lys5.

Target

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MPEPAKSAPAPKKGSKKAVTKAQKKDGRKRKRSRKESYSVYVYKVLKQVH

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using acetylated peptide. The antibody against non-acetylated peptide was removed by chromatography using corresponding non-acetylated peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

13 kDa

Notes

Formerly GWB-ASF129

Specificity

Histone H2B (Acetyl-Lys5) Antibody detects endogenous levels of total Histone H2B protein only when acetylated at Lys5.

NCBI Gene Symbol

H2BS1|LOC102724334

Host or Source

Rabbit

Protein Name

Histone H2B type F-S

Gene Name URL

H2BS1|LOC102724334

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Snrpb2 siRNA Oligos set (Mouse)
44969174 3x 5 nmol

Snrpb2 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Canine Coiled coil domain containing protein 110 (CCDC110) ELISA Kit
GTR10363861 96 Well

Canine Coiled coil domain containing protein 110 (CCDC110) ELISA Kit

Sign In for Pricing
View Details
Fibronectin Recombinant Monoclonal Antibody
RAA00298-01 100 µL

Fibronectin Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Fibronectin Recombinant Monoclonal Antibody
RAA00298-02 200 µL

Fibronectin Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Goat Olfactory Receptor 5AN1 (OR5AN1) ELISA Kit
MBS7259483-01 48 Well

Goat Olfactory Receptor 5AN1 (OR5AN1) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 5AN1 (OR5AN1) ELISA Kit
MBS7259483-02 96 Well

Goat Olfactory Receptor 5AN1 (OR5AN1) ELISA Kit

Sign In for Pricing
View Details