What is the catalog number for SERPINB3/4 Antibody?

The catalog number for SERPINB3/4 Antibody is OAAF08169-100UG.

What sizes are available for SERPINB3/4 Antibody?

SERPINB3/4 Antibody is available in the following size(s): 100 µg.

Is SERPINB3/4 Antibody in stock?

SERPINB3/4 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

SERPINB3/4 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Serpin family B member 3|serpin family B member 4

Gene Aliases

HsT1196; LEUPIN; peptidase inhibitor 11; PI11; protease inhibitor (leucine-serpin) ; protein T4-A; SCC; SCCA1; SCCA-1; SCCA2; SCCA-2; SCCA2/SCCA1 fusion protein; SCCA-PD; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 4; serpin B3; serpin B4; serpin peptidase inhibitor, clade B (ovalbumin), member 3; serpin peptidase inhibitor, clade B (ovalbumin), member 4; squamous cell carcinoma antigen 1; squamous cell carcinoma antigen 2; SSCA1; T4-A.

Gene ID

6317|6318

Swiss Prot

P29508|P48594

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from the Internal region of human SERPINB3/4.

Target

May act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. Also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH (2) -terminal kinase (JNK1) .|May act as a protease inhibitor to modulate the host immune response against tumor cells.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

KTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIK

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol