Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB3/4 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Serpin family B member 3|serpin family B member 4

Gene Aliases

HsT1196; LEUPIN; peptidase inhibitor 11; PI11; protease inhibitor (leucine-serpin) ; protein T4-A; SCC; SCCA1; SCCA-1; SCCA2; SCCA-2; SCCA2/SCCA1 fusion protein; SCCA-PD; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 4; serpin B3; serpin B4; serpin peptidase inhibitor, clade B (ovalbumin), member 3; serpin peptidase inhibitor, clade B (ovalbumin), member 4; squamous cell carcinoma antigen 1; squamous cell carcinoma antigen 2; SSCA1; T4-A.

Gene ID

6317|6318

Swiss Prot

P29508|P48594

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from the Internal region of human SERPINB3/4.

Target

May act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. Also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH (2) -terminal kinase (JNK1) .|May act as a protease inhibitor to modulate the host immune response against tumor cells.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

KTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIK

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Format

Liquid.// PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.

Reconstitution

-20°C

Molecular Weight

44 kDa

Specificity

SERPINB3/4 Antibody detects endogenous levels of SERPINB3/4 protein.

NCBI Gene Symbol

SERPINB3|SERPINB4

Host or Source

Rabbit

Protein Name

Serpin B3|Serpin B4

Gene Name URL

SERPINB3|SERPINB4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPRR2D CRISPR/Cas9 KO Plasmid (m)
sc-423139 20 µg

SPRR2D CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Au-Flat 2 µm 2 µm Hole Pattern on 200 Gold Mesh Box of 50
M-CEM-AUFT222-50 50 Grids

Au-Flat 2 µm 2 µm Hole Pattern on 200 Gold Mesh Box of 50

Sign In for Pricing
View Details
P70 S6 Kinase alpha (Phospho Ser427) Polyclonal Antibody
BT-AP12693-01 20 µL

P70 S6 Kinase alpha (Phospho Ser427) Polyclonal Antibody

Sign In for Pricing
View Details
P70 S6 Kinase alpha (Phospho Ser427) Polyclonal Antibody
BT-AP12693-02 50 µL

P70 S6 Kinase alpha (Phospho Ser427) Polyclonal Antibody

Sign In for Pricing
View Details
P70 S6 Kinase alpha (Phospho Ser427) Polyclonal Antibody
BT-AP12693-03 100 µL

P70 S6 Kinase alpha (Phospho Ser427) Polyclonal Antibody

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5 + 123A8), CF647 conjugate, 0.1mg/mL
BNC470693-100 1x 100 µL

CD56 / NCAM (123C3.D5 + 123A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details