Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHAG Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Rh associated glycoprotein

Gene Aliases

Ammonium transporter Rh type A; CD241; erythrocyte membrane glycoprotein Rh50; erythrocyte plasma membrane 50 kDa glycoprotein; mutant Rh associated glycoprotein; OHS; OHST; Rh 50 glycoprotein; rh family type A glycoprotein; rh type A glycoprotein; RH2; Rh50; RH50A; Rh50GP; Rhesus associated polypeptide, 50-KD; rhesus blood group family type A glycoprotein; rhesus blood group-associated ammonia channel; Rhesus blood group-associated glycoprotein; RHNR; SLC42A1; truncated RhAG glycoprotein; truncated Rh-associated glycoprotein.

Gene ID

6005

Swiss Prot

Q02094

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from the N-terminal region of human RHAG.

Target

Associated with rhesus blood group antigen expression (PubMed:19744193) . May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane (PubMed:11062476, PubMed:11861637) . Involved in ammonia transport across the erythrocyte membrane (PubMed:21849667, PubMed:22012326) . Seems to act in monovalent cation transport (PubMed:18931342, PubMed:21849667) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFEL

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1 mg/ml

Format

Liquid.// PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.

Reconstitution

-20°C

Molecular Weight

44 kDa

Fragment

IgG

Specificity

RHAG Antibody detects endogenous levels of RHAG protein.

NCBI Gene Symbol

RHAG

Host or Source

Rabbit

Protein Name

Ammonium transporter Rh type A

Gene Name URL

RHAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat C1q And Tumor Necrosis Factor Related Protein 1 (C1QTNF1) ELISA Kit
abx517015 96 Tests

Rat C1q And Tumor Necrosis Factor Related Protein 1 (C1QTNF1) ELISA Kit

Sign In for Pricing
View Details
Orobol 7,3',4'-trimethyl ether
FO65379 1 mg

Orobol 7,3',4'-trimethyl ether

Sign In for Pricing
View Details
Sheep Zinc Finger Protein GLI2 (GLI2) ELISA Kit
MBS9358089-01 48 Well

Sheep Zinc Finger Protein GLI2 (GLI2) ELISA Kit

Sign In for Pricing
View Details
Sheep Zinc Finger Protein GLI2 (GLI2) ELISA Kit
MBS9358089-02 96 Well

Sheep Zinc Finger Protein GLI2 (GLI2) ELISA Kit

Sign In for Pricing
View Details
Sheep Zinc Finger Protein GLI2 (GLI2) ELISA Kit
MBS9358089-03 5x 96 Well

Sheep Zinc Finger Protein GLI2 (GLI2) ELISA Kit

Sign In for Pricing
View Details
Sheep Zinc Finger Protein GLI2 (GLI2) ELISA Kit
MBS9358089-04 10x 96 Well

Sheep Zinc Finger Protein GLI2 (GLI2) ELISA Kit

Sign In for Pricing
View Details